KEGG   Penicillium digitatum: PDIP_25770Help
Entry
PDIP_25770        CDS       T04849                                 

Definition
(RefSeq) Cyclin, putative
  KO
K15564  CTD kinase subunit beta
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pdp03021]
    PDIP_25770
Transcription machinery [BR:pdp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    CTDK-I complex
     PDIP_25770
  RNA polymerase I system
     PDIP_25770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 Cyclin_N GST_N GST_C_2 GST_C MRP-S34
Motif
Other DBs
NCBI-GeneID: 26230897
NCBI-ProteinID: XP_014536732
UniProt: K9GW31
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MPAQSDSSLYHEASGPAKALVDRHRAEQPLKLYAGWFCPFVQRVWLALEEKKIPYEYIEV
NPYNKPESLLTLNPRGLVPTLSTPADPHPRPLYESTVILEYLEEAYPDHQPRLLPEDAYE
RARSRIWIDYVTSRIIPSFHRFLQYQSADGSGQNVDAGLDQARQEFLSHLKAWAKEMHTE
EPFFLGEEISLPDLVLAPWAGRLWVFDEFKSGGLGIPREGEGGSDEVIWSRWRTWLAAIK
RRQSMKETTSDLAHYLPMYKTYADNTAQMRLQGVAWIDSVRRALNLPIRTFDTAVGYYHR
FRLVHPDNEYNWTDAAAAALFTACKIEDTLKKSRDIVCAAYNLKVAPSEHLSADDPMFES
NARGIIGLERLMLEASGFDFRTRHPHKTLMKLGRHYGLPQNSEVSNLAYRISSDLYRTFA
PIKQNSSTMAFSCLELAGRLLDQRVEQVESGLDYAQWSTSRAEIMETLFDLLELYTHHRA
LTAVGSEFPADRFLTVRIPLNQEASKYNIPRYQPWVGQPPRPSNGTGANYQDTPRPAHPL
TPIAANGDRQRTGERGRDAAVRFMLDPACADEERRQVAEYFKVEVEEYEVDD
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccaatctgattctagcctctatcacgaggctagtggcccggccaaggcgctg
gtcgatcggcatcgcgctgaacagccattaaagctgtatgcggggtggttctgccccttt
gtccaacgagtctggctcgcccttgaagagaaaaagatcccatacgaatacatcgaggtc
aacccatacaacaagccagagtcgctactcacactgaatccccgaggcctagtccctaca
ctatcaacgccagcagatccacatccacggccactgtatgaatctactgtcatcttggag
tatttggaagaagcatacccagaccaccaaccccgcttactaccagaggatgcctacgag
cgtgcccggtcacgcatctggattgactatgtgacatctcgaataattccatctttccac
cgtttcctgcaataccagtctgcagatggcagtgggcagaacgtagatgcggggttggat
caggctcggcaagagttcttgagtcacctgaaagcttgggctaaggagatgcacaccgag
gaacctttcttccttggtgaggagattagtctgccggatctagtgctggccccgtgggcg
ggacgactttgggtgtttgatgagttcaagagtggtggattagggattccgagggagggg
gaagggggctcggatgaggtgatttggagtcggtggaggacgtggctagctgctatcaaa
cgcagacagagtatgaaggagaccaccagtgatcttgcgcattaccttcccatgtacaag
acatatgccgataacacagctcaaatgcgtcttcagggcgtggcgtggatcgacagcgtg
cggagagccctcaaccttcccattcgtacgtttgacacagcagtgggatactatcaccga
tttcgattggtgcaccccgacaatgagtataattggactgatgctgcggctgcggctcta
tttacagcatgcaagatcgaagatacgctcaaaaagtcgcgagacattgtctgcgcagca
tacaacttgaaagtggcgccctcggagcacttatctgctgatgatcccatgtttgaatcc
aatgcgcgtggcatcataggtcttgaacgactgatgttagaggcctctgggtttgacttt
cgaacccggcatccccacaagaccctcatgaagcttggtcggcattatggactaccacaa
aactctgaagtatccaatcttgcctaccgcatttcgtcggatctttatcgcacattcgcc
cccatcaaacaaaattcctcgacgatggcgtttagctgccttgagcttgcaggacgactc
ttggatcaacgcgtcgaacaagtggagtctgggctagactatgcgcagtggagcaccagc
cgagcagaaatcatggaaaccctcttcgacctcctagaactctacacccaccaccgcgca
ctaaccgctgtcggctcggaattccccgcagaccggttcctaacagtccgcattccgctc
aaccaagaagccagcaaatataacatcccgcgctaccagccgtgggttggccagccaccc
aggccatctaacggcacaggcgccaactaccaagatactccacgacctgctcatccctta
acaccgattgccgcgaacggggaccgccagaggacaggtgagcgaggccgggacgctgcc
gtgcgattcatgcttgatcccgcatgtgcggatgaggagagacgacaggttgcggagtac
ttcaaggtcgaagtggaagaatatgaagtcgacgattaa

DBGET integrated database retrieval system