KEGG   Penicillium digitatum: PDIP_29930Help
Entry
PDIP_29930        CDS       T04849                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pdp  Penicillium digitatum
Pathway
pdp03030  DNA replication
pdp03410  Base excision repair
pdp03420  Nucleotide excision repair
pdp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PDIP_29930
   03410 Base excision repair
    PDIP_29930
   03420 Nucleotide excision repair
    PDIP_29930
   03430 Mismatch repair
    PDIP_29930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pdp03032]
    PDIP_29930
   03400 DNA repair and recombination proteins [BR:pdp03400]
    PDIP_29930
Enzymes [BR:pdp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PDIP_29930
    6.5.1.6  DNA ligase (ATP or NAD+)
     PDIP_29930
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PDIP_29930
DNA replication proteins [BR:pdp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PDIP_29930
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PDIP_29930
DNA repair and recombination proteins [BR:pdp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PDIP_29930
   NER (nucleotide excision repair)
    Other NER factors
     PDIP_29930
   MMR (mismatch excision repair)
    Other MMR factors
     PDIP_29930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 26231313
NCBI-ProteinID: XP_014536454
UniProt: K9GSY3
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MSSPAKKRKRNGDSSPPKRGIKSFFKEQNTEQINLKGPDVTEQTLSDEALARKLQAEWNK
QENAHTPTEDSQAELQINSVPSMSDPPVLPMVAPVMPKKSTLSLQSSAGTEDTVSLAIPL
DQSPQTFDASQYAAELRSHWEIEGGDASYALLTRAFVLANATTSRIKIVDTLVNFLRVLI
EGDPSSVLPAVWLATNSISPPYDELELGLGGSSISKALKRIYGLNSQGIKTLYNKHGDAG
DVAFEAKKRQSFTLMKPKPLRIKGVYQSLKKIATSKGPGSQETKQRIVEKLLQDARGAEE
SRYIVRTLVQNLRIGAVKTTMLIALARAVLYSKPIGADFEVRPHQLAHLKKDELAEVYIN
AEETVKASYARHPSYNDLVPCLLEIGPTDELLVRCGLTMHIPLRPMLGSITRDLSEMLTK
LQGRDFSCEYKYDGQRAQVHCDEEGKVSIFSRHLELMTEKYPDLVSLVPQIRGEGVSSFI
LEGEVVAVDRETGNLKPFQVLTNRAKKNVEIGDIKVNVCLFAFDLMYLNGEPLLDRPFRE
RRELLRSLFTEIPKHFGWVKSMDATSADSEPVLEFFKSAIDVKCEGIMVKLLDNERGTNP
QANNLIFQEIAPTTTDQANQAASDPKINPKPKEKSTRRKPLLSTYEPDKRLESWLKVKKD
YSTSSETLDLIPIAGWHGHGRKAKWWSPILLAVRNPETGSLEAVTKCISGFTDKFYQSNK
EKYAHGSTNVISRPSYVEYYGEPDVWFEPCEVWEMAFADITLSPTYPAAIGLVSDERGLS
LRFPRFVKVREDKSIDEATSSDYLALLWRKQMERTGEVGEVGEAGQEEGIEEEME
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtccagccaagaagcgaaaaagaaatggagattcgtcaccaccgaagcgcggt
attaagtctttcttcaaagaacagaacactgaacaaatcaatttaaaaggtcccgatgtc
actgagcaaactctctccgatgaagctcttgcgcgcaagctacaggctgagtggaataag
caggaaaatgcacacactcctaccgaagattcacaagctgagctgcaaatcaattcagtt
ccatcgatgtcagacccgcctgttttaccgatggttgcgccggtaatgccaaagaagagc
actctttcactacagtcatcagctgggacggaggatacagtatcccttgcgattccgctg
gatcaaagcccccaaaccttcgacgcgagtcaatatgcagcagaactgcggtcgcattgg
gaaatcgaaggtggggatgcttcttacgctttattaacgagagcctttgtcctggcgaat
gcgacaaccagtcgaataaagattgtggatacgctggtcaactttcttcgggttttgatt
gaaggggacccatcaagtgtcctacctgctgtgtggctagcaaccaattccatatcacct
ccctacgatgaactagagctaggcctgggaggctcctccatctcgaaagcactaaaaagg
atatacgggctcaatagccaagggatcaagaccctgtataataagcacggcgatgcagga
gatgttgcattcgaagccaaaaaacgacaatcatttactctgatgaagccgaagccgtta
aggatcaaaggagtttaccagtcactgaagaaaatcgccaccagcaaaggacctggtagt
caagaaaccaagcagaggatcgtcgagaagcttctacaggatgcgcgcggtgccgaggaa
agccgatacattgtccggacattagtccagaatctgcgaattggcgccgtcaagacgacg
atgctgatagctctcgcacgagctgtcttatactccaagccaatcggcgctgatttcgag
gttcgtccgcatcaacttgcacacttgaaaaaggacgagcttgcggaagtctacatcaat
gcagaagaaaccgttaaagcgtcatacgctagacatcctagttacaatgatttggtgccc
tgcttattagagatcgggcccacggacgagcttttggtcagatgcggcctaaccatgcac
atcccactgagaccgatgctgggcagcatcacacgcgatctgtcggagatgttgacgaag
ctccaaggtcgggacttcagctgcgagtacaagtatgacgggcaacgtgcgcaggtacat
tgtgacgaggaagggaaagtttccatcttctcacgccatctagagctcatgacggagaag
tacccagatcttgtctccctggtcccgcaaatccggggagaaggcgtgtcgagctttatc
ctggagggagaagtagttgccgtggaccgtgagactggcaatcttaagccattccaggtt
ttgaccaatcgcgcaaagaagaacgttgaaatcggagacatcaaagtcaatgtctgtctc
ttcgcattcgacctcatgtatctcaacggcgagcctttgctagaccgtccctttcgagaa
cgccgcgaactacttcgcagtctttttacagagattccaaagcacttcggctgggtgaag
agcatggatgcaacatcagcggattccgagcctgttcttgagtttttcaaatctgccatc
gatgttaagtgtgagggcatcatggtgaaactcctcgacaacgagcgcggcacaaaccct
caagccaacaaccttatctttcaagaaatagcccccacaaccaccgaccaagcaaaccaa
gcagcatccgaccccaaaatcaaccccaaacccaaagaaaaatctacccggcgcaaaccc
cttctctcaacctacgaacccgacaaacgccttgaatcctggctcaaagtaaaaaaggac
tacagcacatcctccgaaactctcgacctaatcccgatagccgggtggcacggccatggg
cgtaaagcgaaatggtggtccccgatcctactcgcagtccgcaacccggaaacaggatcc
ctagaagctgtaacaaaatgcatttccgggttcacagacaaattctaccaaagcaacaaa
gaaaagtacgcgcacggcagcacgaacgtcatctcgcgccctagttacgtcgagtactac
ggcgaaccagacgtgtggtttgaaccatgtgaggtgtgggaaatggcttttgcagatatc
acgctcagtcctacgtatccggctgctattggactagttagcgatgagcgcgggttgagt
ctgcgctttccgcgctttgtcaaggttcgcgaggacaagtctattgatgaggctacctcg
tcggattatctggcgttgctgtggcggaagcagatggagcggactggggaggttggggag
gttggggaggctggccaggaggaggggatagaggaggaaatggagtag

DBGET integrated database retrieval system