KEGG   Penicillium digitatum: PDIP_29950Help
Entry
PDIP_29950        CDS       T04849                                 

Definition
(RefSeq) Glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pdp  Penicillium digitatum
Pathway
pdp00250  Alanine, aspartate and glutamate metabolism
pdp00410  beta-Alanine metabolism
pdp00430  Taurine and hypotaurine metabolism
pdp00650  Butanoate metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
Module
pdp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PDIP_29950
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PDIP_29950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PDIP_29950
   00430 Taurine and hypotaurine metabolism
    PDIP_29950
Enzymes [BR:pdp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PDIP_29950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 26231315
NCBI-ProteinID: XP_014536456
UniProt: K9G704
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MSGIVHPNRADEVQSLLKAVEDLLIPFIRSADENLCGGSTQKNGTNGTHGHTELTVTSLV
NYKKPEELRDILKLEIPEKGTKQEGLIEVLQKVLKYSVNTWHQGFLDKLYASTNAPGVAA
ELILATLNTNVHVYQVSPALTVIEKYTGQRLANLFGLNGPQAGGISVQGGSASNTTSIVI
ARNNLYPSTKTDGNGEYKFVLFTSAHGHYSVEKAAQMLGFGSSAVWPVPIDKVGRMIPAE
LEKLVQKAQSEGRTPFYVNATAGTTVLGSFDPFNEIAAICQKYNMWFHIDGSWGGSFVFS
QRQKHKLAGAEKANSIAINPHKMLGVPVTCSYLLASDMRQFHMANTLPAGYLFHNEEDEP
VSNGDELEVESPEVWDLADLTLQCGRRADSLKLFLGWTYYGNEGYRQQIDSACDIAAHLA
NTIEQHPDFVLISENPPPCLQVCFYYAPGKEFVYPRGIVSNEAQRAKNNSKVTEQVTHAI
VHKGFMVDFAPPSGDDDAAGNGKFFRCVVNVQTTRETVDSLVRTIEEVGPGIVESLKASN
SAVKRLGERGHGPVVHRV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcattgtgcaccccaaccgcgctgatgaagtgcaaagccttctgaaagcagta
gaagaccttcttattccatttatcagatccgcagacgagaatctctgcgggggttcgaca
cagaagaatggcactaatggcacccatggacacactgaactgactgtgacctcgttggta
aattataagaagcccgaagagctgcgggatattcttaagctcgagatcccagagaaaggc
acgaagcaggaaggtctcattgaggttttgcaaaaggtcctgaaatactcggtcaacacc
tggcaccagggctttttggacaagctgtatgcgtcaaccaatgcgcccggcgtggcagca
gagctcatcctcgctaccttgaacaccaacgtacacgtctaccaagtatcacctgcgctg
acagtcatcgagaaatataccggccagcggttggcgaacctcttcggcctgaacggccca
caggcaggaggtatttccgtacaaggcggatccgcatcgaacaccacctccattgtcatt
gcgcgcaacaacctctacccgagcacgaaaacagacggaaacggcgagtacaagtttgtg
cttttcacgagcgcacatggccactacagcgtggaaaaggcagcgcagatgctcgggttc
ggcagcagtgctgtctggcccgtccccattgacaaggtcggccgcatgatcccagccgag
cttgagaagctggtccagaaggcgcagagcgaaggccggacaccgttctatgtcaatgcc
accgcaggcacaaccgtcctgggctcttttgaccccttcaacgaaatcgcagccatttgc
caaaaatacaacatgtggttccacatcgacgggtcctggggcggctcatttgtcttctcc
cagcgtcagaagcataagttagccggcgcagagaaagcaaacagcattgccattaacccc
cacaaaatgctcggcgttccagtcacctgctcgtacctgctggcctcggatatgcgtcag
ttccacatggccaacacccttcccgcgggatatctatttcacaacgaagaagacgagcct
gttagcaacggcgacgagttggaagtcgagtccccggaggtgtgggacctggcagacctc
actctccaatgtggtcgacgtgcggattccctcaagctgtttttgggttggacatactac
ggcaacgagggctaccgacagcagatcgactcagcttgtgacatcgctgcgcacttggct
aacaccatcgagcaacatcccgatttcgttcttattagcgaaaaccccccgccttgtctg
caggtgtgcttttattacgctccaggcaaggagttcgtgtacccgcgcggcattgtttca
aacgaggcacagcgcgcgaagaataacagcaaggtcactgagcaagtgacgcatgcgatc
gtgcacaagggctttatggtagactttgcgcctcccagtggggacgacgatgcggctggg
aacgggaagttcttccggtgcgtggtgaatgtccagacgacaagggagaccgttgattcg
cttgtccgcaccatcgaagaggtgggtcccggtattgttgagtctttgaaggcgagcaac
tcagctgttaagcggcttggtgagcgtggacacggccctgttgtccatcgtgtttga

DBGET integrated database retrieval system