KEGG   Penicillium digitatum: PDIP_42500Help
Entry
PDIP_42500        CDS       T04849                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pdp  Penicillium digitatum
Pathway
pdp00500  Starch and sucrose metabolism
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PDIP_42500
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PDIP_42500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 26232568
NCBI-ProteinID: XP_014535241
UniProt: K9GNI5
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MVRFFWAALWALTLGQVVMAVQQILAPRATGSLDIWLATERVVARQGILNNIGSAGAYAA
NAKPGIVVASPSTSNPNYYYTWTRDSALVFKTLIDLFKNGDSALLDVIEEYINAQAYIQT
VSNPSGDLSGGGGLGEPKFNTDETAFTGSWGRPQRDGPALRATALISFGQWLMDNGYTTY
ATNIVWPIVRNDLSYVAQYWNQTGFDLWEEVSGSSFFTIAAQHRALVEGSTFARQVGVSC
SSCDSQAPQVLCFLQSFWTGSYILANFGGGRSGKDANTLLGSIQTFDPEAGCDDTTFQPC
SARALANHKVVTDSFRSVYSLNSGIAAGKAVSVGRYPEDSYYNGNPWYLCTLAAAEQLYD
AIYTWNQIGSLTITSVSLSFFKDLYSSAAPGTYSSSSDTYASIVSAVKTYADGYVRVVET
YAPSSGSLSEQFSRSDGSQLSARDLTWSYAALLTANERRNAIVPAPWGETSASSVPGQCQ
YTSAVGTFSSATNTAWPSTLTSGSGSGTTTGSGGATTTKTTPATKTTSTITSCTTPTAVA
VTFNVIATTLYGQNIKLAGSISELGSWSPSSAIALSASSYTTSNHLWFVTVTLPAGISFT
YKFIRVVSDGTITWESDPNLSYTVPATCGATAVTVNNTWR
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggttcgatttttttgggctgcgctttgggcgcttactcttggccaggtcgtcatggcc
gtgcaacagatattggcccctcgtgcgacaggaagtttggatatctggttggcgactgaa
cgcgtggtggcaaggcagggtattctgaataacatcggatcggctggtgcctatgctgcg
aatgcaaagccaggcattgtagtcgccagcccgagtacctctaaccctaattattattat
acttggactcgagactcggccctggtgttcaaaactttgatcgatctgttcaagaacggc
gacagcgctttgctagatgtgattgaagaatacatcaatgcgcaggcctacatacagacg
gtgtcaaatccctctggagatctttcgggtggcggtggattgggcgagcccaagttcaat
accgatgagacagctttcacaggctcttggggtcgcccccagcgtgatggaccagccttg
cgagccactgcattgatttcgtttggccaatggcttatggataatggatacaccacctat
gcgaccaacattgtctggcccattgtacgcaacgatctctcctatgttgcccagtactgg
aatcagaccggatttgatctctgggaggaagtttccggctcgtcattctttaccatcgcg
gctcagcaccgcgccttggtggagggaagcacgttcgcaaggcaagtcggggtttcatgt
tcgtcctgtgactctcaggctccgcaggtcttatgcttcttacaatccttctggactgga
tcctacattctggccaactttggtggtggccgctctggcaaagacgccaacaccctgctt
ggcagtattcaaacctttgacccggaggcaggatgtgatgacaccacgttccagccttgc
tcagctcgtgcactcgcgaaccacaaagttgtgactgattcattccggtcggtctactct
ctcaactctggtatcgctgcgggcaaggctgtgtctgttggtcgatacccagaggactcc
tactacaatggtaatccttggtacctgtgcactttggctgcagccgagcagttgtatgat
gctatatacacgtggaaccagatcggttctttgacaatcacatctgtctctttgagcttc
ttcaaggatctgtacagctccgctgcgcctggtacctactcctcttctagtgatacgtac
gcctcgatcgtgagtgctgtcaagacatatgcagatggatacgttcgtgttgtggaaaca
tacgctccctccagtggctccttgtccgagcaattctccaggtccgatggctcgcaactc
tcagcccgtgacctgacctggtcctacgcagccctacttaccgccaacgaacgtcggaat
gccatcgttcctgcaccatggggtgaaacttctgccagcagcgttcctggacaatgtcaa
tatacgtcggctgttggtactttcagcagtgccaccaacactgcctggcccagcactttg
acgagtgggtcaggcagcggaactacgaccggatcaggcggtgcaactaccaccaagacg
actcctgccacgaagactacctcaacgataacatcttgcaccacgccaactgctgttgca
gtgaccttcaacgtgattgccactactttatatggccaaaacatcaagcttgctggatct
atctctgagcttggctcttggtccccaagcagtgctattgcgctgagcgcttcttcatac
actaccagcaaccatctatggttcgtgactgtgactcttccagcgggcattagcttcacc
tataagtttattcgggtagtgagtgatggaacgattacgtgggagagtgacccgaacctg
tcgtatactgttcccgccacctgtggtgccacagctgtgacggttaacaatacctggagg
tga

DBGET integrated database retrieval system