KEGG   Penicillium digitatum: PDIP_42930Help
Entry
PDIP_42930        CDS       T04849                                 

Definition
(RefSeq) Glutathione transferase, putative
Organism
pdp  Penicillium digitatum
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 26232611
NCBI-ProteinID: XP_014534583
UniProt: K9G150
LinkDB All DBs
Position
Unknown
AA seq 783 aa AA seqDB search
MMLTGSIPLTSDIKESVTTDEDDPKAPYAMPTLVVTSIFHTACAFYAYTCIAAIGLWCML
FASSNGRISRRTGADKRMTGFPFKNSEAAKKHRKGLMDSELRLSSPRLGPSMPINDQSNV
HLGQFDPELQPFGPFRPPTGAESQLQNATHAFMRPPQSGEAAKKFIASSSTQQHQSHQGH
PSNGVASPLQPQGQSSGGLRQSQNYNTAVAHAAKVGGALHGAAGGKMAPPASLSQIELVM
ENNARQAQSNSLTTLLSPSQAFQPEFIGLDSSSTDPVSFTGPGELQGFKAVPNPPHLDYW
RDRLFNVDEMITLSEEEFQTYFPHVDNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPK
SDDPEKKKRKRTARERDLCHVKIKVVEYFPVSEISDTTHTIEPIPSNILPGMYTFSLNDD
PAIRNAQTFGVLTPNPGIPPNHPGSNGGRYFTIQRVNGNGANGKNDGVSGGHQHTLEESD
RVKKSSVQRHVLKEKKDKKTRADRVMSQTGQKSYHTKATGLAAETAIKHSADVNLKLYGS
CFCPFVQRVWIALELKGIPYQYIEVDPYEKPQSLLEVNPRGLVPALRHDDWGCYESNVLL
EYVRNASGQFPISITLTNPSQLEDLGAGAAMLPGDPKLRAHCRLWAEHVNRHIVPSFYRI
LQEQDQQKQIEKTQELRDAMEKLLEVAHPKGPFFMGPQMSLVDVQAAPWIIRLRRVLKPY
RGWPDAEEGSRLAIWMNAIEASQHVQATTSTDELYHDSYERYAQNRPNTSQVASAIKAGR
GLP
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaactggctccatccctctgacgtccgacatcaaggagtctgtgacaacagac
gaggatgatcccaaggcgccatacgctatgccgactctagtggtaacctctatcttccat
accgcatgtgctttctacgcgtacacctgtattgcggcaattgggttatggtgcatgctc
tttgctagcagcaacggcaggataagccgccgtacgggtgcagacaagaggatgacaggg
ttccctttcaagaattcggaagcagctaagaaacatcggaagggtctcatggactctgaa
ctgcgactttcatcgccccgtttgggaccatctatgccgataaacgaccagtccaacgta
catttgggccaatttgacccagaattgcagcccttcgggccattccgccctccgaccgga
gctgaatcacagctccagaacgcgacgcatgcgtttatgcgtcctccacaatcaggcgag
gcagcgaaaaaattcatcgcctcttcatccacacaacaacaccaatcgcaccaaggtcac
cctagcaatggagttgcctcgcccttacaaccgcaaggacaatcctctggtggtttgcgt
caatcgcagaactacaacaccgccgttgctcatgcagcaaaggtgggcggggcattgcat
ggcgctgctggtggaaaaatggcgcctccagcgtcgctgtcccaaatcgagctagtgatg
gaaaacaacgcccgtcaagctcagagtaacagcttaacaacgctgctgtcgccgagtcaa
gcgtttcaaccagaatttatcggcctagattctagctccacagatccagtgtccttcact
gggcctggagaactgcagggcttcaaagcggtcccgaaccctccgcacctggattattgg
agagataggttgttcaatgttgatgaaatgatcaccctgagcgaagaggaatttcaaacc
tatttccctcacgttgacaacgtgtactctcatcgctcaacccagcgatacaagcgtaaa
cctttcgtctctcattactgggattgtcgactaaaaggacgaccgccgggaacccccaag
tccgatgacccagaaaaaaaaaagcgcaagcgtacggccagagaacgggatctctgccat
gtcaaaatcaaggtcgtggaatacttcccagtgtcggaaatatcagacacgacccataca
atcgagcccattccatctaacatcctacccggtatgtatactttctctcttaacgatgac
cctgcgatccgaaatgcccaaacatttggtgtgctcacgccgaaccctggcataccacca
aatcatccgggatcgaatggtgggagatatttcaccatacagcgggtgaatggcaatggt
gccaacgggaagaatgacggcgtgagtggcggtcatcaacacacgcttgaagagagcgat
cgtgtcaagaagagtagtgtgcagcgacatgttctgaaagaaaagaaagacaagaagacg
agagcggatcgagtcatgtctcaaacaggccaaaagtcataccatacaaaagcgacgggt
ctggccgctgaaactgcgatcaagcactccgccgatgttaatctcaagctatatggaagc
tgtttctgtcccttcgtgcaacgggtatggattgcattagaactgaaaggtattccgtac
caatacatcgaagtggatccatacgagaagccccagtcgctgttagaggtgaatccaagg
gggcttgttcctgctctgcggcacgacgactgggggtgctatgaaagcaacgtgttgttg
gaatatgtaagaaacgcgagtggccaattccccatttccatcactctgacgaatccctcg
cagctggaggatctgggcgcaggagctgcaatgctcccaggagacccaaagctacgcgcc
cattgccgtctgtgggcagaacatgtcaatcggcatatcgtgccgagtttctaccgtata
ctgcaagagcaggatcaacagaaacagatcgagaagacacaggagctgcgagatgcgatg
gagaagctgctggaggtggcgcatcccaaagggcccttcttcatgggcccgcagatgtcc
cttgtggacgttcaagctgcaccgtggattattcggctgcggcgagtcctgaaaccatac
agaggatggccagatgccgaggagggaagcaggcttgccatttggatgaatgcaatcgag
gccagccagcatgtgcaggcgacaactagcacggatgagctgtaccacgacagctatgag
cgatatgcccaaaaccgcccaaacacatctcaggtcgcaagtgcaataaaagcaggacga
ggcctcccttaa

DBGET integrated database retrieval system