KEGG   Penicillium digitatum: PDIP_43140Help
Entry
PDIP_43140        CDS       T04849                                 

Definition
(RefSeq) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pdp  Penicillium digitatum
Pathway
pdp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PDIP_43140
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PDIP_43140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 26232632
NCBI-ProteinID: XP_014534604
UniProt: K9GIU5
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MAALLSNSARVALRSGASATSKAGAAGLTFARGKATLPDLSYDYGALEPSISGKIMELHH
KNHHNTYVTSYNNALEQLQEAQAKGDIAAQIALKPAVNFHGGGHLNHTLFWENLAPKSAG
GGEPPSGALAQAIDSTYGGFGEFQSKMNAALASIQGSGWAWLVKDKQTGQIGIRTYANQD
PVVGQFEPLLGIDAWEHAYYLQYQNRKVEYFSAIWDVINWKAAEKRFA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcttcttagcaactcggcccgcgttgcccttcgctcgggagcttcggccacc
tccaaggccggagccgcgggcttgacctttgcccgcggcaaggccaccctccccgacctt
tcctacgactatggcgcccttgagccctccatttccggcaagatcatggagcttcaccac
aagaaccaccacaacacatatgtgaccagctacaacaacgcccttgagcagctgcaggaa
gcccaggccaagggagacatcgctgctcagatcgccctcaagcccgctgtcaacttccac
ggtggtggccaccttaaccacactctcttctgggagaaccttgcccccaagagtgctggc
ggtggtgagcccccttctggtgctctggcacaagccattgactccacctacggtggcttc
ggcgagttccagtccaagatgaacgctgctttggctagcatccagggcagtggctgggct
tggctcgtcaaggacaagcagaccggccagatcggcatccgcacttacgccaatcaggac
cctgtcgtcggccagttcgagcctctgctcggcattgacgcttgggagcacgcttactac
ctccaataccaaaaccgcaaggtcgaatatttctccgccatctgggatgtcatcaactgg
aaggcagccgagaagcgcttcgcttaa

DBGET integrated database retrieval system