KEGG   Penicillium digitatum: PDIP_45490Help
Entry
PDIP_45490        CDS       T04849                                 

Definition
(RefSeq) MAP kinase MpkB
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pdp  Penicillium digitatum
Pathway
pdp04011  MAPK signaling pathway - yeast
pdp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    PDIP_45490
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PDIP_45490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdp01001]
    PDIP_45490
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdp03036]
    PDIP_45490
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdp04147]
    PDIP_45490
Enzymes [BR:pdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PDIP_45490
Protein kinases [BR:pdp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PDIP_45490
Chromosome and associated proteins [BR:pdp03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PDIP_45490
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PDIP_45490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 26232867
NCBI-ProteinID: XP_014534839
UniProt: K9GH69
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MVQPSPPAGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYEGFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFRALFPKSNDTALDLLEKLLAFNPAKRIT
VEEALKHPYLEPYHDPEDEPTAPPIPEGFFDFDKNKDALSKEQLKLLIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggttcagccaagccctcccgcgggaggatcccgaaagatctccttcaatgtttccgac
caatatgaaattcaagatgttatcggtgaaggcgcctatggtgtcgtctgctctgccatt
cacaaaccctcggggcagaaggttgccatcaagaagatcacccccttcgatcattccatg
ttctgcctgcgtacactgcgtgagatgaagttgctgcgatactttaaccacgagaacatc
atctccatcttggatattcagcggccccgtaactacgagggattcaatgaagtttatctg
attcaagagttgatggaaacagacatgcatcgggttatccgcacacaagacctctcagac
gaccactgccaatacttcatctatcagaccctgcgtgcactcaaggcaatgcactcagcc
aacgtgctccaccgagacttgaagccctcaaatcttcttctcaatgccaactgtgacctg
aaagtctgcgacttcggtctggctcgttcggccgcctccaccgacgacaattccggattc
atgacagaatatgtggccacacgttggtaccgtgcaccagagatcatgttgacattcaag
gaatacaccaaggctattgatgtgtggagtgtcggctgcatattggctgagatgttgagc
ggaaagcctctcttccctggcaaggattatcaccaccagctgaccctcatcctggatgtc
ctcggcacacccacgatggaagattactatggcatcaaatcccgccgtgcccgcgaatac
atccgctcccttccctttaagaagaagattcctttccgcgcactcttccccaagagcaat
gatacggctctggatctcctcgagaagctgcttgctttcaatccggctaagcgtatcact
gtcgaggaagccttgaaacacccttacctcgagccataccatgatcccgaagatgagcct
actgcaccgcccattcccgagggattcttcgatttcgacaagaacaaggatgcgctgagt
aaggagcagttgaagctcttgatctacgaggaaattatgcggtaa

DBGET integrated database retrieval system