KEGG   Penicillium digitatum: PDIP_45990Help
Entry
PDIP_45990        CDS       T04849                                 

Definition
(RefSeq) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pdp  Penicillium digitatum
Pathway
pdp00250  Alanine, aspartate and glutamate metabolism
pdp00410  beta-Alanine metabolism
pdp00430  Taurine and hypotaurine metabolism
pdp00650  Butanoate metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
Module
pdp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PDIP_45990
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PDIP_45990
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PDIP_45990
   00430 Taurine and hypotaurine metabolism
    PDIP_45990
Enzymes [BR:pdp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PDIP_45990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 26232916
NCBI-ProteinID: XP_014534888
UniProt: K9GLB1
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MVHLAKVKNDNEVLPSARDFDSIPAADTNDYDTNVYGSRFAAAHMPLHEMPEREMPRQVA
ARMIKDELSLDGNPKLNLASFVTTYMEDEIEDIMTEAFSKNFIDYEEYPHSAEIQNRCVN
MIARLFNTPTDPNSENAMGTSTIGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNIVMNS
AVQVCWEKAARYFDIEEKYVFCTDTRFVIDPKEAVDLVDENTIGICAILGTTYTGEYEDV
KAINDLLVERNIDCPIHVDAASGGFVAPFIAPDLEWDFRLEKVVSINVSGHKYGLVYPGV
GWIIWRSPEYLPQELVFNINYLGADQASFTLNFSKGASHVIGQYYQLIRLGKHGYRAIMT
NLTRISDYMSAEFAKMGMVILSETHGRGLPLVAWRLPTNESRVYDEFAVAHQLRERGWIV
PAYTMAPNSEKLKMMRVVIREDFSMNRCDSLIQDFKLAIETLDAMDKSMIAKYKTHMQNH
RNHPRHHSRVHHHYMGEKHSLQGKDGKTHGVC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcgccaaagttaagaatgacaatgaggttctcccctctgctcgggacttt
gactccattcctgccgcggacacaaatgattacgataccaatgtctacggcagtcgcttt
gccgctgcccatatgcctctgcatgaaatgccagagcgagagatgccccgccaggttgct
gcgcggatgatcaaggatgagctgagtctggacggcaatcccaagctcaacctcgccagt
ttcgtcactacctacatggaagatgagatcgaggatattatgaccgaagccttcagcaag
aacttcattgattacgaggaatatccccactccgccgagatccagaaccgatgcgtgaac
atgattgccagactcttcaacactcccaccgatcccaacagtgagaatgccatgggtact
tcaaccattggttcttccgaggctatcatgctgggaacactagctatgaaaaagcgatgg
cagaacaagcgtaaggccgagggcaaggactactcgcgccccaacattgttatgaacagc
gctgtccaggtctgctgggaaaaggctgctcgttatttcgacatcgaggaaaagtacgtc
ttctgcaccgacacccgtttcgtgatcgaccccaaagaggcagtggacttggtggatgaa
aacacaatcggtatctgtgctatcttgggtaccacctacaccggtgaatacgaggatgtc
aaggcgatcaacgacctcttagtggagcgcaacattgactgcccaattcacgttgatgcg
gctagtggtggctttgtcgctccattcattgcccctgaccttgagtgggacttccgcctg
gaaaaggtggtttccatcaacgtctctggtcacaagtatggtctggtctaccccggtgtc
ggatggattatctggcgctctcctgagtatttgccccaggaattggtgttcaacatcaac
tacctaggagccgaccaggccagctttactctgaacttctccaagggtgcttctcatgtc
attgggcagtactaccagctgatccgcctgggcaagcacggataccgtgccatcatgacc
aatctgactcgcatcagcgactacatgtctgcggagttcgcgaagatgggaatggtcatc
ctgagtgagacgcatggccggggcctgcctctggtagcctggcgccttcctacaaacgag
agtcgtgtctatgatgaattcgccgtggcccaccagcttcgcgagcgcggctggattgtg
cctgcctacactatggcgcccaacagcgagaagctgaagatgatgcgggttgtcatccgt
gaagacttcagcatgaaccgatgcgacagcttgatccaggacttcaagcttgctatcgag
accttggatgccatggacaagtccatgattgccaagtacaagacgcacatgcagaaccac
cgcaaccaccctcggcaccactcgcgggttcaccatcactacatgggcgagaaacactcg
ctgcagggcaaggatggcaagacacatggcgtttgttaa

DBGET integrated database retrieval system