KEGG   Penicillium digitatum: PDIP_48670Help
Entry
PDIP_48670        CDS       T04849                                 

Definition
(RefSeq) Glycogen synthase Gsy1, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pdp  Penicillium digitatum
Pathway
pdp00500  Starch and sucrose metabolism
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PDIP_48670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdp01003]
    PDIP_48670
Enzymes [BR:pdp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PDIP_48670
Glycosyltransferases [BR:pdp01003]
 Polysaccharide
  Storage polysaccharide
   PDIP_48670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_trans_1_4 Glyco_transf_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 26233184
NCBI-ProteinID: XP_014533861
UniProt: K9FW72
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MEENGEPIKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLNRAS
AAVEVEELSPSNPAMRETIQSMKERGIDMVYGRWLIEGAPRVLLIDTGTGYRWLDEWKGD
LWTISAIPSPAGDNETNEAIVFGYLVAWFLGEYIAHDRRRAVIAHFHEWLAGVALPLTKK
RHMDLTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHSCD
VFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAMHEFQNLHSQAKEKINDFVRGHFY
GHNDFDLDNTLYLFTAGRYEYRNKGVDMFIEGLARLNHRLKAAGSNMTVVAFIIMPAQTS
SLTVESLKGQAVVKSLRDTIENIEKGIGKRMYERCLSWKEGDNMPDEKDLITSQDRVMLR
RRLFGMKRHGLPPIVTHNMHNDHEDPILNQLRRVQLFNHSSDRVKVVFHPEFLNSANPVL
PLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYG
IYIVDRRAKGVDDSVNQLTEFMFNFTEKSRRQRINQRNRTERLSDLLDWKRMGLEYVKAR
QLALRRAYPSSFEGQEEYFDIIGGTEQKLSRPLSVPGSPRDRSGMMTPGDFASLQEGHEG
LSTEDYIAWKLPEEEEPEEHFPLTLRTRKMPERAASPLDSSSINGCEEAEKGARTE
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaacggcgaacccattaagcgtgatgtgcgcaaccacatgctcttcgaggtg
gccactgaagtggccaatcgagtaggcggcatctactcggtcctcaagtccaaagctcct
gtaaccaccgccgaatatggcgagcgatatactctgatcggtccacttaatagggcttcc
gctgcggtagaggttgaggagctatcgccatccaacccggccatgcgggagacaatccag
tcgatgaaggagcgcggcattgacatggtctacggtcgctggctcattgagggggcccct
cgggttctgctgattgacacgggaactggctatcggtggttggatgaatggaagggcgat
ctttggacgatttcggctatcccctcccccgctggtgataatgagaccaatgaggccatc
gtttttggatatttggtcgcttggttcttgggtgagtacattgcgcacgaccgtcgccgg
gcggtcatcgcccatttccatgaatggttggctggtgtcgccctgccactgaccaagaag
cggcacatggacctcacaactgtcttcacaacccacgcgacattactgggtcggtacctc
tgtgctggctcggttgacttctataataacctccagtactttgacgtggatgcggaggcc
gggaagcgaggaatctaccaccgctactgcatcgagcgagctgctacccattcctgtgat
gtctttactactgtatcccatatcactgcatttgagagtgaacacctgctgaagcggaag
cccgatggcgtgctgcctaatggtctgaacgtcaagaagttctctgctatgcacgaattc
cagaacttgcactcccaggccaaggagaagatcaacgatttcgttcgtggccatttctat
gggcacaatgactttgatctggataataccctatatctttttaccgcgggtcgttatgag
tatcgcaacaagggtgtcgatatgttcattgaggggctggcccgcctcaatcatcgattg
aaggccgccggatcgaacatgaccgtggtcgctttcattattatgccagcacagacctct
tcgttgaccgtagaatcgcttaagggacaggccgtcgtcaagtctctccgcgacaccatc
gagaacatcgagaaggggatcgggaagcgcatgtatgagcgatgtctttcctggaaggaa
ggtgacaacatgcccgacgagaaagatcttatcaccagtcaagatcgtgtgatgctccgc
cgtcgcctgttcggcatgaagcgccatggtcttccccccattgtcacccacaacatgcac
aatgaccacgaggaccccatcctgaatcagttgcgtcgtgtccagctgttcaaccactcc
tccgaccgggtgaaggttgtcttccaccccgaattcctcaactccgccaaccctgtatta
ccgcttgactacgacgactttgttcgtggaacccatctgggcgtcttcccctcctactat
gagccatggggatatacaccggccgaatgtacagtgatgggtgtgcctagcatcaccacc
aatctgtctggattcggttgctatatggaggaattgatagaaaactcctctgattacgga
atttacatcgttgaccgtcgcgccaagggtgttgacgactcggtcaaccaactgaccgag
tttatgttcaacttcacggagaagagtcgtcgccagcgcattaaccagcgtaaccgtacg
gagcgtttgagtgatttgctcgactggaagagaatgggcttggaatatgtcaaggctcgt
caactggcattgagaagagcttacccatcgtccttcgagggtcaagaggaatacttcgat
atcattggagggacggaacagaagctctcccgcccactttccgttccgggatccccacgg
gatcgttccggaatgatgaccccgggcgactttgcttctctacaggaaggtcacgaggga
ttgagcaccgaggattatattgcctggaaattgcctgaagaggaggagcccgaagagcac
ttccccctcacattgcgaacgcgcaagatgccggaacgtgctgcatccccactggacagt
tcatcgatcaatggctgcgaagaggccgaaaagggagcccggacagaatag

DBGET integrated database retrieval system