KEGG   Penicillium digitatum: PDIP_56650
Entry
PDIP_56650        CDS       T04849                                 

Definition
(RefSeq) Xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
pdp  Penicillium digitatum
Pathway
pdp00040  Pentose and glucuronate interconversions
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PDIP_56650
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     PDIP_56650
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N ADH_zinc_N_2 Pyr_redox_2 DUF4403 Methyltransf_25 2-Hacid_dh_C PrmA DapB_N
Other DBs
NCBI-GeneID: 26233981
NCBI-ProteinID: XP_014532891
UniProt: K9GD97
LinkDB
Position
Unknown
AA seq 354 aa
MAAAQNLSFVLQGIHKVKFEDRPVPELKNPHDVIINVKYTGICGSDVHYWEHGSIGSFVL
KDPMVLGHESAGIITQVGSAVKTLKVGDRVAMEPGTSCRRCEPCKAGKYNLCEDMRFAAT
PPYDGTLAKYYVLPEDFCYKLPEHISLQEGALMEPLGVAVHIVRQAGVSPGQSVVVFGAG
PVGLLCCAVATAFGASKVIAVDIQQQRLDFAKDYATTSTFLPSKVAATENAERLREENGL
GVGADVAIDASGAEPSVHTGIHVLRNGGTYVQGGMGRSEIQFPIMAACSKELTIKGSFRY
GSGDYKLAVGLVSSGKVNVKKLITGTVKFDQAEQAFIEVKAGKGIKTLIAGIDV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccgcagcccagaacctttcattcgtccttcagggaatccataaggtgaagtttgaa
gaccgcccggttcccgagctgaagaatccccacgatgtgatcatcaacgtcaagtacacc
ggcatctgcggcagtgatgtccactactgggaacacggctcgattggttcattcgtcttg
aaagatccaatggtgctcggacacgagtcagcaggcatcatcacccaagtcggatcagcc
gtcaaaaccctaaaggtgggcgaccgggtcgctatggagccgggaacctcctgccgccga
tgtgagccttgcaaggccggaaagtacaacctgtgcgaggacatgcgcttcgccgcaacc
ccaccctatgacggcaccctcgccaagtactatgttctccccgaggacttctgctacaag
ctccccgagcacatctccctgcaggagggggcgcttatggagcctcttggtgttgctgtg
catattgtgcgccaagccggcgtcagcccgggtcagtcggtggttgtattcggtgccggc
cccgtaggcttgctgtgctgcgccgtggcgactgcgtttggcgcctccaaggtcatcgcc
gtggatatccagcagcagcgtcttgactttgccaaggactacgcaacgacgtcgacgttc
ctgcctagcaaggttgcagccactgagaacgccgagcgcctgagagaagagaatgggctc
ggcgttggcgccgatgtggcgattgacgcttcgggcgctgagccttccgtgcacacggga
atccatgttctacgtaacggaggcacgtacgtgcagggtggcatgggccgcagcgagatc
cagttccccatcatggcggcgtgctccaaggagctgaccatcaagggtagcttccggtat
ggtagcggagactacaagcttgccgttgggctggtttcctccggaaaggtcaacgttaag
aagttgattaccggcacggtcaagtttgatcaagctgagcaggcctttattgaagtcaag
gctggcaagggcatcaagaccttgattgccggtattgatgtgtaa

DBGET integrated database retrieval system