KEGG   Penicillium digitatum: PDIP_59620Help
Entry
PDIP_59620        CDS       T04849                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
pdp  Penicillium digitatum
Pathway
pdp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PDIP_59620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pdp03400]
    PDIP_59620
Enzymes [BR:pdp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PDIP_59620
DNA repair and recombination proteins [BR:pdp03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PDIP_59620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT DNA_ligase_IV RTT107_BRCT_5 mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 26234278
NCBI-ProteinID: XP_014533188
UniProt: K9GB89
LinkDB All DBs
Position
Unknown
AA seq 974 aa AA seqDB search
MDSDEILSQELLGQEKEEDIKANELKKKLSGPAPARRKVGPNGKGAASLNPFERRRDVIE
RFISRWRKDVGNDIYPALRLILPDKDRDRPMYGIKEKAIGKMLVKIMKINKESEDGYNLL
NWKLPGQGATTRMAGDFAGRCFDVLSKRPMRTEPGDMTIDEVNEKLDKLSAASKEDEQLP
ILTEFYRRMNPEELLWLVRIILRQMKVGATERTLFDVWHPDAENLYSISSSLRRVCWELH
DPNIRLEGEERGIALMQCFQPQLAQFQMHSFEKIIARMKPTEDDHVFWIEEKMDGERMQL
HMAPDDSIQGGRKFGFWSRKAKEYTYLYGNGIYDENGALTRHLKDAFVDGVQSIILDGEM
ITWDPEQDAMVPFGTLKTAALAEQRNPFSNAPRPLFRVFDILHLNGRDLTKYALRDRRNA
LEKTIRPVYRRFEIHSYEEATTTTEVEKALRKVVAEASEGLVLKNPRSPYRLNERHDDWM
KVKPDYMTEFGESLDVVVIGGYYGSGHRGGALSSFLCGLRVDDSTQAAEKCWSFCRVGGG
FTAADYQEVRHHTEGKWKVWDAKKPPTNFIELAGGDAQHERPDMWIKPSDSIVLCAKAAS
VAISDQFRMGLTLRFPRFKKLRKDKDWKSALSVQEFLDLKSNAEQEHREKEFSVDNSRKK
RVKRATKKPLTVAGYDDNIDVQYLEPSGHIFDELNFFVMTESTSPEKKTKLQLEQLVKAN
GGKIYQTKTAAVDTLCVADRRTVKVASLQRSGEQNIIRPSWLIDCIKQNEIDIGLPDLLL
PFEPRHMFFMREDEEEEVVANVDQFMDSYARDTTVEELKEVFKQMEQNQEQPDHALDPET
IQRVEARIQEKINAGYTVPCGWLFRGLKFYFHSNGDRQDESASQELWKKSQPLYLARNTA
RFAGAESASSLKSSGTTHVIVDPETLSSADISSLRKSLAEKPGAKMPHLVSASWVDECWK
NRTLLDEERFPVPR
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggattccgacgagatcctaagtcaggagctcctggggcaagagaaagaagaagacata
aaagcaaatgaactcaagaagaagctatcagggcctgctccagctcgccgaaaagttggt
cccaatggcaaaggtgctgcgagtctcaacccgttcgagcgccggcgcgatgtgattgag
cgcttcatttcacggtggcgcaaggatgtcggcaacgacatttaccctgctcttcgactg
attcttcccgacaaagatcgcgatcgaccaatgtacgggatcaaggagaaggctatcggg
aagatgctcgtcaagatcatgaagatcaacaaagaatcagaagatggatacaatcttctg
aattggaagcttcctggccagggtgctacaacacgcatggcgggtgactttgcgggaaga
tgcttcgatgttctctcgaagcggcccatgcggaccgagccgggtgacatgacgatcgac
gaggttaatgagaagctggataagctatcggctgcatcaaaggaggatgaacaactgcca
atcttgacggaattctaccggaggatgaaccccgaagaacttctgtggctcgtccgcata
atacttcggcagatgaaggttggtgctaccgagcgaacactcttcgatgtctggcatccc
gatgccgagaatctgtacagcatatctagcagtctgcggcgtgtttgctgggagctgcat
gatcccaatatccggcttgagggagaggagcgtggcatcgcgttgatgcaatgcttccag
ccgcagctggcccaatttcagatgcattcatttgagaaaatcattgctcgtatgaaacca
acagaagacgaccacgtcttttggattgaggagaaaatggatggtgagcgtatgcaactc
catatggcgcctgacgattcgatccaaggcggtcgaaaatttggcttctggtcgcgcaaa
gcgaaggaatatacctatctatacgggaacggaatttacgatgagaacggtgctctgaca
aggcatctaaaagatgctttcgtggatggagtacagagcattattctcgacggcgaaatg
attacctgggatcctgaacaggacgccatggttccctttggcacgctcaaaaccgcggcc
ctggcggaacaacgcaatccgttctcaaatgctccacgacccttgttccgtgtttttgat
atattacatctcaatgggcgcgacctaacaaagtatgcccttcgtgatcgtcgtaatgcc
ctggagaagactatccgacctgtatatcgccggtttgaaattcactcttatgaggaagct
actaccaccacagaagttgaaaaggctttgcggaaggttgtcgctgaggcgtcagagggt
cttgtattgaagaacccgcgctctccatatcgactgaacgaacgccatgatgactggatg
aaagtaaaaccagactatatgaccgaatttggagagtcccttgacgttgttgtgattggc
ggatactatggttcaggtcatcgaggaggtgcgctgtccagttttctttgtggactacga
gtcgacgacagcacacaagcagcagaaaaatgctggtccttttgtcgggttggtggcggg
ttcacagcagctgactaccaggaggtccgccatcatacagagggcaagtggaaggtgtgg
gatgcgaaaaagcctccgactaactttatcgaactggcgggcggagacgcccagcatgaa
cgtccagatatgtggatcaaaccatccgactcgattgtcttgtgtgcaaaagctgcatct
gtcgcaatcagtgatcaatttcgcatgggattgacgttgcgcttccctcgctttaagaaa
ttgcgcaaggacaaggactggaaaagcgcgctctcggttcaggagtttcttgatctaaag
tctaacgcagagcaagagcatcgggagaaggagttctctgttgataactctcggaagaaa
cgagtgaagagggccactaagaaaccgctcaccgttgccgggtacgacgataatatcgat
gtccagtatcttgaaccttctgggcatatcttcgatgagcttaacttctttgtaatgacc
gagtcgaccagcccagaaaagaaaacaaaacttcaactggaacaactcgtgaaggctaat
ggtggtaagatatatcaaaccaagacagctgcggtagacaccctctgtgttgctgatcgg
agaacggtcaaagtagcctcattacaaaggagtggagagcaaaacatcattcgaccatct
tggcttatcgactgcatcaagcagaatgagatagatataggcctgccagatcttcttctt
ccgttcgaaccacgacacatgtttttcatgagagaggacgaagaggaagaagtcgtagca
aatgtcgaccaatttatggacagctacgctcgcgatacaactgttgaggagctcaaggaa
gtattcaagcaaatggaacaaaaccaagagcagcccgaccatgccttggacccagaaacc
attcagagagtcgaggctcgcatccaggaaaaaataaatgctggttacacagtgccctgc
gggtggctcttccgaggcttgaagttttacttccactcgaacggggatcggcaggacgaa
tcagcctcccaagaactgtggaagaagagccaaccactctacttggctcgcaacacagcc
cggtttgcaggtgccgagagcgccagctccttgaagagctcgggcaccacacatgtgata
gtcgacccggagactttgtcgtcagcggacatatcatctctccgaaagtctctggccgag
aagccaggtgcgaaaatgccgcatcttgttagtgcgagctgggtggacgaatgctggaaa
aatcgcacattgctggatgaagagagattcccggttccgcgatga

DBGET integrated database retrieval system