KEGG   Penicillium digitatum: PDIP_62070Help
Entry
PDIP_62070        CDS       T04849                                 

Definition
(RefSeq) Glucokinase GlkA, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pdp  Penicillium digitatum
Pathway
pdp00010  Glycolysis / Gluconeogenesis
pdp00051  Fructose and mannose metabolism
pdp00052  Galactose metabolism
pdp00500  Starch and sucrose metabolism
pdp00520  Amino sugar and nucleotide sugar metabolism
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
pdp01130  Biosynthesis of antibiotics
pdp01200  Carbon metabolism
Module
pdp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pdp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PDIP_62070
   00051 Fructose and mannose metabolism
    PDIP_62070
   00052 Galactose metabolism
    PDIP_62070
   00500 Starch and sucrose metabolism
    PDIP_62070
   00520 Amino sugar and nucleotide sugar metabolism
    PDIP_62070
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PDIP_62070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdp04131]
    PDIP_62070
Enzymes [BR:pdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PDIP_62070
Membrane trafficking [BR:pdp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PDIP_62070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 26234523
NCBI-ProteinID: XP_014533433
UniProt: K9G581
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MSSSLLDQATRIARDFDYPAEKVQRGVAEYIKQSNEGLTQEGTTLSQIPTFVTAVPNGTE
RGLYLAVDLGGTNFRVCSVLLHGDTTFSLTQSKILIPRELMASGTSKDLFLFLARQIESF
LRIHHNEHFEAHQLRRREDYKEEDMFDLGFTFSFPVRQCGINRGTLIRWTKGFNIPDAVG
HDVCALLQSAIDVLNLPVRVAALVNDTVGTLMARSYTSPGKTGTFLGAIFGTGTNGAYLE
KTKNITKLQHMKDAHFDDPTGEMIINAEWGSFDNHMSVLPTTVFDDELDADSNNPGVQMF
EKRVSGMFLGEILRRALLSLHRNTDLGLFKANENSKVVIPEGSMLFRQWGLDTSMLSSVE
ADSSKDLVDVKTALKDHLEIENPSFEECQAVKIIVHAIGKRAARLSAVPLAAILVHTNKL
ETDDIIDIGVDGSLVEFYPNFEGYMREALREVPQVGVAGDKKIRIGISKDGSGVGAALIA
LIANKDNGLEIPREN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcattattggaccaggccacgcgcattgcgcgtgacttcgactaccccgcc
gagaaagtgcaacgcggggttgccgagtacatcaagcagtccaacgagggcttgacccaa
gagggcaccaccttgagccaaattcctaccttcgtgactgcagtgccaaatggcacagaa
aggggcctttatttggctgtggatctcggtggcacgaatttccgtgtgtgctcggtcctc
ttgcacggcgatactaccttctccctcactcaatccaagatcctcattcctcgggagttg
atggcctccggcacctcgaaggatctcttcctgttcctggcccgccaaatcgaatcattc
cttcgcattcaccacaatgaacatttcgaggcccaccagcttcgccgacgggaggattac
aaggaagaggacatgttcgatttgggctttaccttcagtttccccgtgcgccagtgtggc
atcaaccgcggaacactgatccgttggaccaagggcttcaacattcctgatgcggttggc
cacgacgtttgcgcgctgcttcagtccgccattgatgttttgaacctgccagtacgtgtg
gctgcacttgtgaacgataccgtcggtactctcatggcccgctcatatacctcgccaggc
aagactggcactttcctgggtgccattttcggaaccggtaccaacggtgcttatctggag
aagaccaagaacatcaccaagctccagcacatgaaggatgcccactttgatgaccccaca
ggcgagatgatcatcaacgctgaatggggtagcttcgacaaccacatgagcgtgttacct
accacggtgttcgatgatgagctcgatgccgatagcaacaaccccggtgtgcagatgttt
gagaagcgtgtttcaggcatgttcttgggtgaaatcttgcgccgtgcgctcctgtctcta
caccgcaacaccgacctgggattgttcaaggccaacgagaattccaaggtcgtcattcca
gaaggatcgatgcttttccgtcaatggggtcttgacaccagcatgctgagttcagtcgag
gctgatagcagcaaggacttggtggatgtgaagaccgcattgaaggatcacctcgaaatt
gagaaccccagctttgaagaatgccaggccgtgaaaatcatagttcacgccattggaaaa
cgtgccgctcgtctgagcgctgttccgttggctgccattctcgtgcacaccaacaaactt
gagactgatgacatcattgacatcggtgtcgatggcagtctcgttgaattctatcccaat
tttgaagggtatatgcgggaggctttgcgtgaagttcctcaggtcggagttgcaggcgac
aagaagatccgcattggtatttccaaggatggcagcggtgttggcgcagctctgattgcg
ctcatcgctaacaaggataatggcctcgaaattccccgcgagaactaa

DBGET integrated database retrieval system