KEGG   Penicillium digitatum: PDIP_71920Help
Entry
PDIP_71920        CDS       T04849                                 

Definition
(RefSeq) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pdp  Penicillium digitatum
Pathway
pdp00730  Thiamine metabolism
pdp00790  Folate biosynthesis
pdp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PDIP_71920
   00790 Folate biosynthesis
    PDIP_71920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdp04147]
    PDIP_71920
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pdp00537]
    PDIP_71920
Enzymes [BR:pdp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PDIP_71920
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PDIP_71920
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pdp00537]
 Enzymes
  PDIP_71920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF2486
Motif
Other DBs
NCBI-GeneID: 26235508
NCBI-ProteinID: XP_014531349
UniProt: K9FF39
LinkDB All DBs
Position
Unknown
AA seq 599 aa AA seqDB search
MAREESLLPPRLSDDGLSIRNEEEDYALLTGERTAPQNKRRVWPSWREIGVFSWALVATI
LVIVLAVIYPRKSAEPHDHYASNTTWGPGGKPTGKRNMIFMVSDGMGPTSLSLTRGFRQY
TDDLPFEDVLVLDKHYIGTSRTRSSSSLVTDSAAGATAFSCGRKSYNSAISVLPDHSPCG
TVLEAAALAGYKTGLVVTTRLTDATPACFAAHANLRNYEDLIAAQEVGEHPLGRVVDLLL
GGGRCHFLPNSQDGSCRGDDHDLIKVAAQNGFGYINDRAGFDSLQGGDNATLPLLGLFAS
GDIPFEIDRRTQNETYPSLEEMTRTALKALSKATEDSEHGFFVMIEGSRIDHAGHGNDPA
AQVHEVLAYDRAFAAALEFLENDSTPGVIVSTSDHETGGLSAARQLHKTYPEYLWLPSVL
DKASHSAEYLAARLEEYLSGPGKDAKDPAKQSWVRQSLKDGLAIDDATDHEVDALLHPAP
NVTPSYVFADMISRRAQVGWSTHGHSAVDVNIYASSTKDAWPLVGNQENTDVGDFLADYL
DLNVDKVTKLLQDTKSGTSPSYDWMGDPLGLNFHTEGLDTYHGDFRKRSIDECGCGAAH
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggaagagtccctcctacctccgcggctgtccgatgacggcttgtcgattcga
aatgaagaagaggactacgctcttctaaccggcgagcgaacggcccctcaaaacaagcga
cgagtctggccttcctggcgggaaattggagtgttttcctgggcccttgttgcaacaatt
ctggtaattgtgctggccgtgatctacccacgcaagtcggcagagcctcacgaccactac
gcgtcaaacacaacctggggtcctggaggcaagccgacgggcaagcggaacatgatattc
atggtgtctgacggcatgggacctacgagtctctcgctgactcgaggctttcggcaatac
acggatgatctgccattcgaagacgttctggtcttggataagcattacatcggaacctcg
cgaacacggtcaagctctagcttggtgacagactccgcggctggagcgacggccttttcg
tgcggccgcaagagctacaactctgccatttcagtgcttcccgaccactcgccttgtggg
actgtgctcgaggcggctgcgttggcgggttataagacaggcctggttgtgaccacccgc
ctgacggatgcgaccccagcatgctttgctgcgcatgccaatttgcggaactacgaagat
ctgatcgccgcccaagaagttggagaacaccctctcggtcgggtggtagaccttctgctt
ggcggtgggcggtgccatttcttgcccaactcacaggatggcagctgtcgtggtgatgat
catgatttgatcaaggtcgctgcccagaatgggtttggttatatcaatgaccgtgcgggc
ttcgatagcctccagggcggcgataatgccactttaccactgctaggtctctttgctagc
ggggacatcccgttcgaaattgatcgacgcactcaaaacgagacctatccctctctggag
gagatgactcgcacggccttgaaggccttgagcaaggccaccgaggacagcgagcatggg
ttctttgtcatgatcgagggctctcgcatcgaccatgctggtcatggtaatgaccctgcc
gctcaggttcacgaagtactagcatacgatagggcctttgctgccgcgctcgagttccta
gagaatgactccactcctggtgtgattgtgagcacatctgaccacgagactggcggtctt
tccgcagcacggcagttgcacaagacctaccctgagtacttgtggcttccgagtgttctg
gacaaggcaagccactctgccgaataccttgccgctcggctagaagaatatctttctggg
ccaggcaaggacgccaaggatccggctaaacagtcttgggtccggcaaagtcttaaggat
gggcttgctattgatgatgctacagaccatgaagtagatgccctgctccacccggccccc
aacgtcaccccgtcatacgtgtttgcggacatgatcagtcgccgcgcccaggttggctgg
agcactcatggacattctgctgtcgacgtcaatatctacgcgtcttctaccaaagacgct
tggccattggttggcaaccaggaaaacaccgacgtgggagacttccttgctgactatctt
gatctcaatgtcgacaaggtcacgaagttgctgcaggacaccaagtctggaacctcgcca
tcatatgactggatgggtgatccccttggcttgaacttccataccgagggattagacact
taccatggagacttcaggaagcgatctatcgatgagtgtggatgtggggctgcccactaa

DBGET integrated database retrieval system