KEGG   Penicillium digitatum: PDIP_76070Help
Entry
PDIP_76070        CDS       T04849                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
pdp  Penicillium digitatum
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdp01001]
    PDIP_76070
Enzymes [BR:pdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PDIP_76070
Protein kinases [BR:pdp01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   PDIP_76070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 26235923
NCBI-ProteinID: XP_014531764
UniProt: K9FC35
LinkDB All DBs
Position
Unknown
AA seq 404 aa AA seqDB search
MAAQPPSGQKPKVQPCRYKTGKTLGAGSYSVVKECVHIDTGRYYAAKVINKRLMSGREHM
VRNEIAVLKKVSLGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYYESDAAD
LIRAVLSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQFHVLTTT
CGTPGYMAPEIFKKSGHGKPVDIWAIGVITYFLLCGYTPFDRDSNLEEMQAILAADYSFT
PLEYWRGVSQEARNFIRSCLTVNPQSRMTAYEALQHPWVNLAYDSGKVGSGEDLLPTVKK
NFNARRTLHRAIDTVRAINKLREGGGFMMDGVMSVDPNPERVNGGDIITEKQHAPLPAPV
NARGPTQMQIDSRGNARGQTEEQIRAQERRVKEMVAGLWSRTPR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacaacccccgagcggccagaagccgaaggtccagccgtgccgatacaagact
gggaagacattgggcgctggttcgtactctgttgtgaaggaatgtgtgcacatcgatacc
ggtcgctattatgcggcgaaggtcatcaacaagcgtctcatgtccgggcgggagcacatg
gtccggaatgaaattgcggtattgaagaaggtgtcgctgggtcaccagaacattctcaca
ctggtcgactactttgagactatgaataacttatacctcgtgactgatctcgcgctgggt
ggggaactctttgaccgcatctgtcgcaaaggcagctactacgagtctgacgctgcggac
cttatccgcgcagtgctctccgccgtggcctatctacatgaccatgggatcgtgcaccgt
gatctgaagcctgagaacctgcttttccgcacaccagaagacaacgccgatctactgatt
gccgatttcggattgtcaaggatcatggacgaggagcagttccatgtcctgactacgacc
tgcggaacgccaggatacatggcaccagagatcttcaaaaaaagcggccatggcaagcca
gtcgacatctgggccatcggcgtgatcacctacttcctgctatgcggatacacgcccttc
gaccgggattccaatctcgaggagatgcaagcaatcctagcagcagactactcctttacg
ccgctcgagtactggcgtggtgtatcacaagaagcgcgcaacttcatccgcagctgtctg
acagtcaacccgcagtcacggatgacagcctacgaagctctccagcacccctgggtcaat
ctggcctatgacagcggcaaggtcggctcgggtgaagatctgctgccgacagtcaagaaa
aacttcaatgcgcgccgcacgctgcaccgtgctatcgacactgtgcgggctatcaacaag
ctccgcgagggcggtggcttcatgatggatggcgttatgagcgttgatcctaatcccgag
cgtgtcaacggtggtgatatcatcaccgagaagcagcatgcccctctgcctgcgccggtc
aatgctcgtggcccgacgcagatgcagattgatagtcgtggtaatgcgcgtgggcagact
gaggagcagatccgggctcaggagcggagggtcaaggagatggttgctggtttgtggagc
cgtacgccacgttag

DBGET integrated database retrieval system