KEGG   Penicillium digitatum: PDIP_89420Help
Entry
PDIP_89420        CDS       T04849                                 

Definition
(RefSeq) CAMP-dependent protein kinase PKAC catalytic subunit
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pdp  Penicillium digitatum
Pathway
pdp04113  Meiosis - yeast
pdp04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    PDIP_89420
  09143 Cell growth and death
   04113 Meiosis - yeast
    PDIP_89420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdp01001]
    PDIP_89420
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdp03019]
    PDIP_89420
   03036 Chromosome and associated proteins [BR:pdp03036]
    PDIP_89420
Enzymes [BR:pdp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PDIP_89420
Protein kinases [BR:pdp01001]
 Serine/threonine kinases: AGC group
  PKA family
   PDIP_89420
Messenger RNA biogenesis [BR:pdp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PDIP_89420
Chromosome and associated proteins [BR:pdp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PDIP_89420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 APH FDF dbPDZ_assoc
Motif
Other DBs
NCBI-GeneID: 26237256
NCBI-ProteinID: XP_014530344
UniProt: K9FSJ5
LinkDB All DBs
Position
Unknown
AA seq 391 aa AA seqDB search
MPSLGGLLKKRRTKDSQDLGKSDTQNHDGSRASMQPASHASPQHTGTGTHENAASIDNII
NQEQPKQERVTKGKYSQEDFELQRTLGTGSFGRVHLVQSNHNHRFYAMKVLKKAQVVKMK
QIEHTNDERRMLNRVRHPFLITLWGTWQDSRNLYMVMDFVEGGELFSLLRKSQRFPNPVA
KFYAAEVTLALEYLHSHQIIYRDLKPENLLLDRHGHLKITDFGFAKDVPDITWTLCGTPD
YLAPEVVSSKGYNKSVDWWSLGILIFEMLCGFTPFWDSGSPVKIYENILRGKVKYPPYLH
ADAVDLLSQLITSDLTKRLGNLHGGPSDVKNHAWFAEVTWDRLARKDIDAPYIPPIRGGQ
GDASQYDKYPEETEHYGQEGEDPYGHLFPDF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtctaggaggtttactgaagaagaggcgaacgaaggattcgcaagatctaggg
aagtcagatacacagaaccacgacggttcacgcgcatccatgcaacccgcttcacacgct
tcgccccagcacacgggtacgggtacacacgaaaatgccgccagtatcgacaacatcata
aaccaggagcagcccaaacaggagcgtgttacaaaggggaagtactctcaggaggacttc
gagcttcagcgcaccttgggaacggggagcttcggtcgtgtccacctggtgcagtctaac
cacaatcatcgcttctatgcgatgaaagtgttgaagaaggcccaggtggtcaagatgaag
caaatcgagcacacaaatgacgagcgccgcatgttaaatcgtgtccgccatccattcctc
attacattgtggggaacttggcaggattcccgaaacctctacatggtcatggactttgtg
gagggaggcgaattgttcagtctcctgcgcaagtcacaacgattcccgaaccccgtggcc
aaattctatgccgcggaggtcaccctagcgctggagtatttgcactcacaccagataatc
tatcgtgatttgaagcccgaaaaccttctgctggaccgtcatggtcatctgaagatcacg
gattttggatttgccaaagacgtgccggatattacttggacactctgtggtactcccgac
tacctggcacccgaggtcgtctcttccaagggatataacaaatcagttgactggtggtca
ttgggaatcctaatctttgaaatgctgtgtggattcactcccttctgggacagcgggtct
ccagtcaagatctatgagaatatcctgcgcggcaaagtcaagtatcctccatacttgcac
gccgacgccgttgatctgctctctcagttgatcacatccgacctcaccaagcgcctcggc
aacttgcacggtggcccgagtgatgtcaagaatcatgcctggttcgccgaggtcacttgg
gaccgactagctcgtaaggatattgacgcgccgtatatcccacccatccgcggtggacaa
ggcgatgcaagccaatacgacaagtatccggaagaaacagagcactatggccaagaagga
gaagacccatatggccaccttttccccgacttctaa

DBGET integrated database retrieval system