KEGG   Polynucleobacter duraquae: CL55_00000900Help
Entry
CL55_00000900     CDS       T04207                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq00550  Peptidoglycan biosynthesis
pdq01100  Metabolic pathways
pdq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CL55_00000900
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CL55_00000900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdq01003]
    CL55_00000900
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdq01011]
    CL55_00000900
Enzymes [BR:pdq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CL55_00000900
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CL55_00000900
Glycosyltransferases [BR:pdq01003]
 Polysaccharide
  Bacterial polysaccharide
   CL55_00000900
Peptidoglycan biosynthesis and degradation proteins [BR:pdq01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CL55_00000900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AKD24423
UniProt: A0A0E3V0A2
LinkDB All DBs
Position
80417..82753
Genome map
AA seq 778 aa AA seqDB search
MALPPKDKPPLNGRFNRQPDRRPGQPRGGSFSPNKSGSNPLIKALLIISMVFAVVVTLLL
GYAFLVAKPNLPKISALIDYNPKTPLRIYTADKVLIGEFGEERRKVIPLNEIPMSMRNAV
LAIEDDRFYSHGGVDYVGILRATLTNLRGNLSQGASTITMQVARNFFLSNEKTFSRKIYE
VLLAWEIESQLSKDKILEIYMNQIFLGQRAYGFSSAAQIYFGKDLKDITIAESAMLAGLP
KAPSAYNPVSNFRRAKIRQEYILQRMRDLSYITPEQYQIAMAEELHIRGLGNEFSTRADF
PAEMVRQLLITQYGEAIYSQGIDVYTTILKADQDAAYKAVRRGIFEYDLRHAYRGPEGFI
DLPEDTVKRQRAIDEALLAYPQLDDLQSGVVLDIKPKEMQVMIATGDTITIKGESMKLAA
AALTDSTQPKKRLRPGAIVRLLSDGGVWKLAQLPQVEAAFVSMNTETGAILSLVGGFDFR
RNKFNHVTQAQRQPGSSFKPFIYAAAIEKGFSPSTMVNDAPLSIGGLETGSQAWEPKNYD
GKYEGLMRLRTALAKSKNLVSVRLIRSIGPSYAQDYIQRFGFEAEKHPPYLTMALGAGSV
TPLQMASAYSVFANGGYRVDPYLINKMTDSKGTVLFEAKPTHAREDAPRVLDARTSFVLD
SMLQEVTKTGTAASARAKLGRNDIAGKTGTTNESHDAWFAGYNPKVVAIAWIGFDKPASL
GDRETGGGLALPMWISYMSTALRDEPQQSREVPAGVTQVDGDWFIPEFSNNGGVRELQ
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggctctacccccaaaagacaagccgccattaaacgggcggtttaaccgacaacctgat
agacgccccggtcagccaagaggagggtcattctcgcccaataaatctggaagtaatccg
ctcatcaaagcgcttctgattattagtatggtttttgcggtggtggttaccttgttgctg
ggatatgctttcttagtagcaaagccgaatctgccaaagatttcagccttgattgattac
aaccccaaaacaccattgcgtatctatacggctgataaagttctcataggtgagtttggg
gaggagcgccgtaaggtaatacctttaaatgaaatcccaatgagtatgcgtaatgcagtt
ttagccattgaggatgatcgcttttactctcatggtggagtggattacgtgggtatcctg
agggctacgcttacgaatttacggggcaatctttcccagggtgcctcaaccatcacaatg
caagtggcgcggaactttttcctcagtaatgagaaaactttcagtcgtaagatttatgag
gttctcttagcttgggaaattgagtctcaattaagtaaagataagattcttgagatttat
atgaatcagatctttttggggcaaagagcttatggattttctagtgcagcccaaatctac
tttggtaaagatctaaaagacattacgatcgctgaatcagcaatgctggctggcttacca
aaagcaccatcggcatataaccctgtaagcaattttcggcgcgccaaaattcgacaggaa
tacattttgcagcgcatgcgtgatttgtcgtacatcactcccgagcaatatcaaattgca
atggctgaagagttacatatccgtggactcggtaatgaatttagtactcgcgcagatttt
cctgctgagatggttcgtcaactcctgattacacaatatggcgaggcaatctattcgcag
ggaatagatgtatacaccacgatcttgaaggcagaccaagacgccgcatataaagcagtg
cgtcgcggcatttttgagtacgacttacgtcacgcatatcgtggtcccgagggattcatt
gatttgccagaagatacagtgaagcgccaacgtgcaattgatgaagctttgttggcttat
ccgcaattggacgatttgcagtcaggcgtagtgctcgatattaagccaaaagaaatgcag
gtcatgattgctactggagatacgatcaccataaaaggtgagagtatgaagcttgctgct
gctgctttaacggatagcactcaaccaaaaaaacgtttgcgtcctggtgcgatcgttagg
ctactctcagacggtggcgtttggaagttggcgcagttacctcaagttgaagctgctttt
gtttcaatgaataccgagacgggggcgatcctttctttggtgggcggctttgattttcgt
cgaaataagtttaatcatgtcacccaggctcaacgccaaccgggttcttctttcaagcca
tttatttatgccgccgcgatcgagaaaggtttttctccaagcacaatggtgaatgatgcc
ccgctatcgattggtggcctggaaacagggagtcaagcttgggagccaaagaactacgat
ggcaagtatgagggtttaatgcgcttacgcactgccttagcaaaatcaaaaaacttggtt
tcagtgagattaattcgctctattggaccatcttatgctcaagactatattcaacgtttt
ggatttgaggcggagaagcacccaccttatttgacaatggctttgggcgcaggttctgtt
acacctttgcaaatggcatccgcttatagcgtttttgctaatgggggatatcgtgtagac
ccctatttaattaataagatgacggactcaaaaggcacggtgctgtttgaggccaagcct
actcatgcgcgtgaagatgccccccgtgtgttggatgcgcgaacttcttttgtgttggac
agtatgttgcaagaagttacgaaaaccggcactgcggccagtgcaagagcgaaattaggc
cggaatgacattgccggcaaaacaggtactacgaatgagtctcacgatgcttggtttgcg
ggatataacccgaaggtagttgcaattgcttggataggctttgataaacccgcaagtttg
ggcgatcgtgaaactggtggaggcctcgctttaccaatgtggatctcttatatgagtact
gccttgagggatgagccacaacaatcacgcgaagtgcctgcgggcgtaacccaagtggat
ggtgattggtttattcctgagttttctaataacggcggtgtacgcgaactgcagtag

DBGET integrated database retrieval system