KEGG   Polynucleobacter duraquae: CL55_00001790Help
Entry
CL55_00001790     CDS       T04207                                 

Definition
(GenBank) Aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pdq  Polynucleobacter duraquae
Pathway
pdq00030  Pentose phosphate pathway
pdq01100  Metabolic pathways
pdq01120  Microbial metabolism in diverse environments
pdq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CL55_00001790
Enzymes [BR:pdq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CL55_00001790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKD24512
UniProt: A0A0E3ZIH7
LinkDB All DBs
Position
168707..170554
Genome map
AA seq 615 aa AA seqDB search
MSWAGKLLRVNLTAGTCVSEPINMKWAKEYLGSRGLASKYLVEELDPKVDPLSAENKMIW
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGYWGAELKMAGWDMVIVEGKSPKPVY
LFIENDKAELIDASDLWGKTVWETEPAIKTKHQDPQIRVSCIGRAGENEVLYAAIVNDLH
RAAGRSGVGAVMGSKNLKAVAVRGTKGVGNIKNPKAFMEATRAGKAVLAGNAVTGEGLPT
YGTQVLMNVINEVGALPTRNHQDVQFDGAKDISAEAMATPRATDGKAHLVTNQACFACTI
ACGRISKIDDTHFSIENKPQYMNASGGLEYEAAWALGAANGVNDLEALQFANMLCNEDGF
DPISFGATVGAVMEMYEMGVLTKEQLGIEAPFGSAKALCYFAEITANGVGFGKELGLGSA
RLTKKYGQPDLSMSVKGQEFPAYDGRVIQGIGLAYATSNRGACHLRGYTIASEVLGIPVK
TEPADTQGKPELVKAFQDATAAFDSAGICIFTSFAWTLADVAPQLQAACGDEFTVENLTT
IGERIWNMERDFNNRAGFTSKDDRLPKRLMTEAAKTGPGKGTVSGLDKMLPEYYKIRGWD
PEGRPSAETLKRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgggctggaaaattactacgcgttaatctaactgcaggcacttgtgtctcagaa
ccaatcaatatgaagtgggctaaagaatatttaggctctcgagggttggcttcgaagtat
ttggttgaagagttggatcctaaggttgatccactatccgctgaaaacaaaatgatttgg
gcaactggcccgctgactggaacgatggcatcgactggtggtcgctacaccgtggtgact
aagggcccgttgaccggcgccattgcctgctctaactctggtgggtactggggtgcagag
ctgaaaatggcaggctgggatatggtgattgttgaaggtaaatcacccaagccggtttat
ctttttattgagaacgacaaagcagagttgatcgatgcctcggatttgtggggtaaaact
gtttgggaaacagagcccgcaattaagactaaacatcaagaccctcaaattagagtctct
tgtattggacgtgctggtgaaaatgaagttctttacgctgcaattgtgaatgacttacat
cgtgcagctggacgctctggtgtaggcgcagtgatgggaagtaaaaacttaaaagcagtt
gcagttcgaggcacaaaaggcgttggcaatattaagaatcctaaagcctttatggaggca
acccgcgctggtaaggcggtattggctggaaatgctgtaactggagaaggtttaccaacc
tacggcactcaagtattgatgaatgtgattaatgaggttggtgcgttacccacccgcaat
caccaggatgttcagtttgatggagctaaagatatttctgcagaagcaatggcgacgcca
cgtgcaactgatgggaaagcccatctagttaccaatcaagcctgttttgcatgcacgata
gcttgtggtcgtatctcaaaaattgacgacacgcatttctcaattgaaaataaaccacag
tatatgaatgcctcgggtggtttggagtatgaggctgcatgggctttaggcgccgcaaat
ggcgtcaacgatttagaggctctccagtttgccaacatgttgtgcaatgaagatggcttt
gatcctatttcttttggtgcaactgtgggcgctgtgatggaaatgtatgagatgggtgtt
ttaactaaagagcagcttggtattgaagctccgtttggttctgctaaagcactctgttat
ttcgcagaaattactgcaaatggtgttggcttcggaaaagagcttggacttggttctgca
cgtttgaccaaaaaatacggacagcccgacctctctatgagcgtcaaaggtcaagagttt
cctgcttatgatgggcgcgtgattcagggtattggcttggcgtatgcaacttcaaaccga
ggcgcatgtcacttacgcggctacacgattgcttctgaggttttgggtattccagtaaag
actgaaccagcagatacgcaaggcaagccagagttggtgaaagcatttcaagatgcgact
gctgcctttgattcggcgggaatttgtattttcacgagctttgcttggacgcttgctgat
gtggcgccacaattgcaggctgcatgtggagacgagtttacggtagagaatttgactacg
attggtgagcgtatctggaatatggagcgtgactttaataaccgtgcaggtttcaccagt
aaggacgatagattgccgaagcgcttaatgacggaggctgcaaaaactggcccaggcaag
ggcactgtgagtggtttagataagatgctgcctgagtactataagatccgaggctgggat
cctgagggtcgtccaagtgcagaaacgcttaagcgtcttggtctgtaa

DBGET integrated database retrieval system