KEGG   Polynucleobacter duraquae: CL55_00004950Help
Entry
CL55_00004950     CDS       T04207                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdq  Polynucleobacter duraquae
Brite
KEGG Orthology (KO) [BR:pdq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CL55_00004950
Enzymes [BR:pdq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CL55_00004950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 DAO Thi4 AlaDh_PNT_C NAD_binding_7 FAD_oxidored NAD_binding_8 K_oxygenase FMO-like NAD_binding_9 Thioredoxin_9 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AKD24828
UniProt: A0A0E3V0Q6
LinkDB All DBs
Position
complement(464087..465631)
Genome map
AA seq 514 aa AA seqDB search
MLDTNIKTQLKAYFEKIESPIILEATLDDSTHAAQMLELLNEVAEQSTKITVKTSGSSKN
IPSFTVGKVDEVARIAFSGLPMGHEMTSFILAILQASGYPPKVEQDVIESIKSLEGKKHF
QTFISLSCHNCPDVVQALNLMAALNPDIEHEMIDGALFQGLVDQYQIMAVPTVILNGEVF
GQGRMSVEEIAAKLDTNTSARDAEKLSAKAAYDSLIIGGGPAGASAAIYSARKGIRTGVV
AQRFGGQVADTVGIENFISVKETEGPKLVMALEQHVKEYEVDVMNLQTAKSLSKTGDEIT
ITLENGAVLKSKTVILSTGARWREMNVPGEQEYRGKGVAYCPHCDGPLYKGKRVAVIGGG
NSGVEAAIDLAGIVSHVTLVEFDTKLRADAVLQKKMHSMPNVTVITNALSKEVLGADGKV
TTLRYEDRTNNQIHDIALEGIFVQIGLLPNTDWLKGVIDLSPRGEVIIDQKGETSMPGVF
AAGDCTTVPYKQIIIAMGEGAKASLSAFDYLIRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttagataccaatatcaaaacccaactcaaagcctattttgaaaaaatagaaagcccg
attattttagaagccactttggatgacagtactcacgcggctcaaatgctagagctactg
aatgaagttgccgagcaatctactaagatcactgtaaaaacctcaggtagtagtaaaaat
attcctagctttaccgtaggtaaggtggatgaagttgctcgtattgcattctctggccta
cctatgggtcatgaaatgacttctttcattttggctattttgcaagctagtggctaccca
ccaaaggttgagcaagatgtgatcgagagtattaaaagcttggaaggtaaaaagcacttt
cagacattcatttctttgtcatgccataactgcccggatgttgttcaggccctaaacctg
atggccgctcttaatcccgatatcgaacatgaaatgattgatggcgccctcttccagggt
ttggttgatcaatatcaaatcatggctgtacctaccgtgattctgaatggcgaagtattt
ggtcagggtcgtatgagcgttgaagaaattgctgctaaattggataccaatacctcagca
cgtgatgcagaaaaattgagcgctaaagctgcttatgactctctgattatcggtggagga
ccagcaggtgcttcagctgcaatttactctgcccgtaaaggaatcaggactggtgttgtg
gctcaacgctttggtgggcaggtagctgataccgtagggattgaaaacttcatttccgtt
aaagaaactgagggccctaaattagtgatggcgcttgagcagcacgtcaaagaatacgaa
gtcgatgtcatgaatctgcagaccgccaagagcctgagcaagactggcgatgagattacg
atcaccttagaaaatggtgccgttctgaagagtaagacagtcattctgagtacaggtgca
cgctggcgcgaaatgaatgtgccgggcgaacaagagtaccgcggtaaaggcgttgcttac
tgccctcactgtgatggtccgctctacaaaggcaagcgtgtcgcagtaattggtggaggc
aactctggggttgaggctgcaattgatttggcgggcattgtgagtcatgtcaccttagtt
gagtttgacactaagttgcgtgccgatgccgtgctgcagaaaaaaatgcatagcatgcct
aacgttacggtaattactaacgcattaagtaaagaggtgttgggtgccgacggtaaggta
actaccttgcgctatgaagatcgcactaacaaccagatacatgacattgcgcttgagggt
atctttgttcagatcggcttgctaccgaatacagattggctcaagggtgtgattgattta
tctcctcgcggtgaagtgatcatcgatcaaaaaggtgagacttccatgcccggtgtcttt
gctgccggagactgtactacagtaccttacaagcaaattatcatcgctatgggtgaagga
gcaaaggcatcactttcagcatttgattatttaattcgctcataa

DBGET integrated database retrieval system