KEGG   Pseudomonas sp. ATCC 13867: H681_00935Help
Entry
H681_00935        CDS       T02524                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdr  Pseudomonas sp. ATCC 13867
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H681_00935
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     H681_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin DAO Thi4 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGI22069
UniProt: M4WQT2
LinkDB All DBs
Position
211946..213511
Genome map
AA seq 521 aa AA seqDB search
MLDATLKTQLKAYLEKVQQPFEIVASLDDSDKSREMSELLHEIVGLTDKITLREDGSDER
KPSFALNRPGANIGLAFAGIPMGHEFTSLVLALLQVGGHPSKLDADVIEQIKGIQGSFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQEEVERRQVMAVPSIYLNGEVF
GQGRMGVEEILAKIDTGAAAREAEKLSAKEEFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVTETEGPKLARQLEEHVKHYDVDIMNLQRASALIPAKTAGG
LHEVQFEGGGSLKAKSVILATGARWREMGVPGEKEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLFSLPNVEVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSIDLEGIFVQIGLLPNSEWLKGTIELTPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgctacgcttaaaacccagttgaaggcttatctggaaaaggtccagcagcct
ttcgaaatcgtcgcgtccctcgatgacagcgacaaatcccgcgagatgagcgagctgctg
cacgaaatcgtcggcctgaccgacaagatcaccctgcgtgaagatggcagcgacgagcgc
aagccgtccttcgcgctgaaccgcccgggggcgaacatcggcctggctttcgccggcatc
cccatgggccacgaattcacctccctggtgctggcgctgctgcaggtcggcggccacccg
tccaagctcgacgctgacgtcatcgagcagatcaagggcatccagggttcgttcgagttc
gaaacctatttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgccttgttccaggaa
gaagtcgagcgccgccaggtgatggctgtgccgagcatctacctcaacggcgaagtgttc
ggccagggccgcatgggcgtggaagaaatcctcgccaagatcgacaccggcgccgctgcc
cgcgaagccgagaagctgtcggccaaggaagagttcgacgtgctggtcgtcggcggtggc
ccggcgggcgccgcggcggcgatctacgccgcccgcaagggcatccgcaccggcgttgcc
gccgagcgtttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
accgagaccgaaggtccgaaactggctcgccagctggaagagcacgtcaagcactacgac
gtcgacatcatgaacctgcagcgcgccagcgcgctgatcccggcgaagaccgccggcggc
ctgcacgaagtgcagttcgagggcggcggcagcctcaaggccaagtcggtgatcctggcc
accggcgcccgctggcgcgaaatgggcgtgccgggtgagaaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggtgtcgaggcggccatcgacctggccggcatcgtgtcccacgtg
accctgctggagttcgacagcaagctgcgcgccgacgccgtactgcaacgcaagctgttc
agcctgccgaacgtggaagtgatcaccagcgcgctgaccagcgaagtgaaaggcgatggc
cagaaggtcaccggcctggtctacaaggaccgcaactcggaagagttcaagtccatcgat
ctggaaggcatcttcgtgcagatcggcctgctgcccaacagcgaatggctcaagggcacc
atcgagctgaccccgcgtggcgagatcatcgtcgacgctcgcggcgagacctcgctgccg
ggcatcttcgccgccggtgacgtgaccaccgtaccgtacaagcagatcgtgatcgcggtc
ggcgaaggcgccaaggcgtcgctctccgccttcgaccacctgatccgctcctccgcgcca
gcctga

DBGET integrated database retrieval system