KEGG   Pseudomonas sp. ATCC 13867: H681_01820Help
Entry
H681_01820        CDS       T02524                                 

Definition
(GenBank) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00260  Glycine, serine and threonine metabolism
pdr00270  Cysteine and methionine metabolism
pdr00450  Selenocompound metabolism
pdr01100  Metabolic pathways
pdr01130  Biosynthesis of antibiotics
pdr01230  Biosynthesis of amino acids
Module
pdr_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H681_01820
   00270 Cysteine and methionine metabolism
    H681_01820
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    H681_01820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdr04147]
    H681_01820
Enzymes [BR:pdr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     H681_01820
Exosome [BR:pdr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H681_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AGI22246
UniProt: M4WSX3
LinkDB All DBs
Position
396706..397875
Genome map
AA seq 389 aa AA seqDB search
MSQHDDRLGFATRVIHAGQEPDPSTGAIMPPIYANSTYRQESPGVHKGLDYGRSHNPTRW
ALERCVADLEGGSKAFAFASGLAAISAVLELLDAGSHIVSGNDLYGGTFRLFERVRRRSA
GHDFHFADLAQPGALEAALTDKTRMVWVETPSNPLLRLTDLAAIARTCRERGILCVADNT
FASPYVQRPLDLGFDIVVHSTTKYLNGHSDVIGGIAIVGDNPDLVERLGFLQNSVGAIAG
PFDAFLTLRGVKTLALRMERHCANALELAKWLEQQPQVKRVYYPGLASHPQHELARRQMK
GFGGMISLDLNTDLAGSRRFLENVRLFALAESLGGVESLIEHPAIMTHASIPAENRAALG
IGDSLIRLSVGVEDVEDLRTDLARALATI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacgacgaccgcctcggtttcgccacccgtgtgatccacgccgggcaggag
ccggacccgtccaccggggcgatcatgccgccgatctacgccaactccacctaccgccag
gaaagccccggcgtgcacaaggggctcgactacggccgctcgcacaaccccacgcgctgg
gcgctggagcgctgcgtggcggacctggagggcggcagcaaggcgttcgccttcgcctcg
gggctggcggcgatctcggcggtactggaactgctcgacgccggctcgcacatcgtctcc
ggcaacgacctctacggcggcaccttccgcctgttcgagcgggtgcgccggcgcagcgcc
gggcacgacttccacttcgccgacctggcccagcccggcgccctggaagcggcgctgacc
gacaagacgcgcatggtctgggtggaaaccccgagcaacccgctgctgcgcctgaccgac
ctggccgccatcgcccgcacctgccgcgagcgcggcatcctctgcgtggccgacaacacc
ttcgccagcccctacgtgcagcgcccgttggacctgggcttcgacatcgtcgtgcattcg
accaccaagtacctgaatggccactccgacgtcatcggcggcatcgccatcgtcggcgac
aaccccgacctcgtcgagcgcctgggcttcctgcagaactcggtgggcgccatcgccggc
ccgttcgatgccttcctcaccctgcgcggagtgaagaccctcgccctgcgcatggagcgg
cactgcgccaatgcgctggagctggccaagtggctggagcaacagccgcaggtgaagcgt
gtgtattaccccggcctggcctcgcatccgcagcacgagctggcgcgccggcagatgaag
ggcttcggcgggatgatctcgctggacctgaacaccgacctggccggctcgcggcgcttc
ctggagaacgtccggttgttcgccctggcggaaagcctgggtggcgtggaaagcctgatc
gagcacccggcgatcatgacccatgccagcatcccggcggagaatcgcgcggcgctgggg
attggcgattcgctgattcgcctgtcggtgggggtggaagacgtggaggacctgcgcacc
gacctggcaagggcgttggcgacgatctga

DBGET integrated database retrieval system