KEGG   Pseudomonas sp. ATCC 13867: H681_05550Help
Entry
H681_05550        CDS       T02524                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K03599  stringent starvation protein A
Organism
pdr  Pseudomonas sp. ATCC 13867
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pdr03021]
    H681_05550
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdr02000]
    H681_05550
Transcription machinery [BR:pdr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     H681_05550
Transporters [BR:pdr02000]
 Other Transporters
  Pores ion channels [TC:1]
   H681_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AGI22990
UniProt: M4XCE3
LinkDB All DBs
Position
1215898..1216515
Genome map
AA seq 205 aa AA seqDB search
MAAINKLTCFSDPSCHYSHRVRLVLAEKSVVADIIDVPAGSIPAKLAEVNPYGSLPTLVD
RDLALYESTVVMEYLDERYPHPPLLPVYPVARANSRLLMHRIQRDWCALVDRILDSRRKD
AERALARKELRESLTGVSPLFADKPFFLSEDLSLVDCCLLPILWRLPVLGIELPRPAKPL
LDYMERQFARETFRASLSSIERDMR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaatcaacaagctcacctgcttctccgacccttcctgccactacagccatcgc
gtgcgcctggtgctggccgagaagagcgtcgtcgccgacatcatcgacgtacccgccggc
agcatcccggccaagctcgccgaagtgaacccctatggcagcctgccgacgctggtggat
cgcgatctcgccctctacgagtcgacggtggtcatggagtacctcgacgagcgttatccc
catccgccgttgctgcccgtctatccggtggcgcgtgccaacagccggttgctgatgcac
cgcatccagcgcgactggtgtgccctggtggaccgcatcctcgattcacgccggaaggac
gccgagcgcgccttggcgagaaaggaattgcgtgagagcctgacgggggtatctccgctg
ttcgccgacaaaccgttcttcctcagtgaggatctgagtctggtggattgctgcctgctg
ccgatcctctggcgattgccggtcctgggcatcgagctgccgcgcccggccaagccgctg
ctggattacatggagcgacagtttgcgcgggaaactttccgtgcgagcctgtcctctatc
gaacgtgatatgcgctaa

DBGET integrated database retrieval system