KEGG   Pseudomonas sp. ATCC 13867: H681_05640Help
Entry
H681_05640        CDS       T02524                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00473  D-Alanine metabolism
pdr00550  Peptidoglycan biosynthesis
pdr01100  Metabolic pathways
pdr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    H681_05640 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H681_05640 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    H681_05640 (ddl)
Enzymes [BR:pdr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     H681_05640 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pdr01011]
 Precursor biosynthesis
  Amino acid ligase
   H681_05640 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 RimK ATPgrasp_YheCD TTL ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AGI23008
UniProt: M4WSD7
LinkDB All DBs
Position
1234469..1235416
Genome map
AA seq 315 aa AA seqDB search
MSDVLKSTLDPRAFGRVAVLYGGKSAEREVSLKSGAMVLQALQDGGVDAFGIDVGDDLLE
RLTREKIDRAFIILHGRGGEDGTMQGLLEIAGIPYTGSGVLASALAMDKLRTKRVWLSLG
LPTPDHAVLASEDDCRTAAAKLGFPLIVKPASEGSSIGMAKVNSEQELIAAWAGAAKYDS
QVLVEQWISGPEFTIAVLRGQVLPPIRLGTPHTFYDYDAKYLASDTRYQIPCGLDAAKEE
ELKDLTARACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLDFQ
QLVLAILADSVEARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtcctcaaatccaccctcgatccccgcgccttcggtcgcgtcgccgtgctt
tacggcggcaagagcgccgagcgcgaggtatcgctgaagtccggcgccatggtcctgcaa
gcgctgcaggacggcggtgtggatgccttcggcatcgacgtgggcgacgatctgctggag
cgtctgacccgcgagaagatcgaccgtgccttcatcatcctccacggtcgtggcggtgaa
gacggcaccatgcaggggctgctggaaatcgccggcattccctacaccggcagcggcgta
ctggcgtccgcgctggcgatggacaagctgcgcaccaagcgcgtgtggctgagcctgggc
ctgccgacgcctgaccatgccgtgctcgccagcgaggacgattgccgcaccgccgccgcg
aagctcggcttcccgctgatcgtcaagccggccagtgaaggttcgagcatcggcatggcc
aaggtgaacagcgagcaagagctgatcgctgcctgggcgggggccgcgaaatacgattcg
caggtgctcgtcgagcaatggatcagcgggcccgaattcaccatcgccgtcctgcgtggc
caggtgttgccgcccattcgcctgggtactccgcacaccttctacgactacgacgccaag
tacctcgccagcgatacccggtaccagattccctgtggcctcgacgccgccaaggaagag
gaactgaaggacctgaccgcgcgcgcctgcgatgccctcggcatccagggctggggccgg
gccgacgtgatgcaggatgccgaagggcgtttctggcttctggaagtgaacaccgcaccg
ggcatgaccgaccacagcctggtgccgatggccgcgcgcgcggccggcctggatttccag
caactggtgctggcgatcctcgccgacagcgtcgaggcaagggggtaa

DBGET integrated database retrieval system