KEGG   Pseudomonas sp. ATCC 13867: H681_09435
Entry
H681_09435        CDS       T02524                                 

Definition
(GenBank) two-component sensor PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr01503  Cationic antimicrobial peptide (CAMP) resistance
pdr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H681_09435
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    H681_09435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdr01001]
    H681_09435
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pdr02022]
    H681_09435
   01504 Antimicrobial resistance genes [BR:pdr01504]
    H681_09435
Enzymes [BR:pdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     H681_09435
Protein kinases [BR:pdr01001]
 Histidine kinases
  OmpR family
   H681_09435
Two-component system [BR:pdr02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   H681_09435
Antimicrobial resistance genes [BR:pdr01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    H681_09435
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HATPase_c_2 HAMP HATPase_c_3 FlgN PhoQ_Sensor
Other DBs
NCBI-ProteinID: AGI23761
UniProt: M4WX17
LinkDB
Position
2066038..2067381
AA seq 447 aa
MIRSLRLRLMIGAATLAILFMAALLPALQRAFSIALENAIQQRLAADVATLVSAARIEGG
RLSMPDHLPVEDFNLPESKLLGYIYDQNGRLVWRSTSAQDESVEYVPKYDGLVDEFTRIR
DRSGQEFFVYDVEIDLLGGTQAAYSIVTMQPESDFRELVRGFREQLYVWLGGALLVLLGM
LWLGLSWGFRSMRGLRAELDQIEAGERERLSDEHPDEMLRLTGSLNRLLDSERAQRERYR
NSLGDLAHSLKTPLAVLQGVSENLAAQPQNREQVQVLQTQIERMSQQIGYQLQRASLRKS
GLIRHRAALEPLLDTLSGALDKVYRDKRVLLERDMPEGFALPLEQGALLEMLGNLLENAY
RLCLTTVKVSARKQGRFFELVVEDDGPGVPGSQRERILKRGERLDTQHPGQGIGTAVVKD
IIDSYDGELALEDSELGGACFRIRLPG
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgattcgttcgctgcgcctgcgcttgatgatcggcgcggcgacgcttgccatcctgttc
atggcggctttgctgccggcgctgcagcgggctttcagcattgccctggagaacgccatc
cagcagcgcctggcggccgatgtggcgacgctggtgtcggcggcgcgcatcgagggcggg
cggctgagcatgccggaccatttgccggtggaggatttcaacctccccgaatccaagctg
ctgggctacatctacgaccagaatggccgattggtctggcgctccacctcggcgcaggat
gagagcgtggagtatgtccccaagtacgatggcctggtcgacgagttcacgcgcatccgc
gatcgctccggccaggaatttttcgtctacgacgtggaaatcgacctgctcggggggacg
caggcggcctacagtattgtcaccatgcagccggagagcgacttccgcgaattggtacgg
ggtttccgcgaacagctctacgtgtggctgggcggagcgctgctggtactgctggggatg
ctctggctcggtttgagctggggctttcgctcgatgcgcgggctgcgtgccgagctggat
cagatcgaggctggcgagcgtgagcgcctgagcgatgagcacccggacgagatgctgcgc
ctgaccggttcgctgaaccgcctgctcgacagcgagcgcgcccagcgcgagcgctaccgc
aattccctgggcgatctcgcccacagcctgaagacgccgctggcggtgctgcagggcgtc
agcgagaacctcgccgcgcagccgcagaaccgcgagcaggtgcaggtgctgcagactcag
atcgagcgcatgagccagcagatcggctaccagttgcagcgcgccagcctgcgcaagagc
ggcctgatccggcatcgtgcggcgctcgaacccttgctcgacaccctcagtggggcgctg
gacaaggtctaccgcgacaagcgcgtgctgctggagcgcgacatgcccgagggattcgcc
ctgccgctggagcagggcgcgctgctggaaatgctcggcaatctgctggaaaacgcctac
cgcctgtgcctgacgacagtaaaggtcagcgcccgcaagcagggccgtttcttcgagctc
gtcgtcgaggacgacggtcccggcgttccgggcagccagcgcgagcgtatcctcaagcgc
ggcgaacgcctggacacccagcaccccggccagggcatcggcacggcggtggtgaaggac
atcatcgacagctacgacggcgaactggcgctggaggattccgagttgggtggggcgtgc
ttccggattcgcctgccggggtga

DBGET integrated database retrieval system