KEGG   Pseudomonas sp. ATCC 13867: H681_12870Help
Entry
H681_12870        CDS       T02524                                 

Definition
(GenBank) peptide synthase
Organism
pdr  Pseudomonas sp. ATCC 13867
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Transferase
Motif
Other DBs
NCBI-ProteinID: AGI24444
UniProt: M4WXB3
LinkDB All DBs
Position
complement(2883280..2896065)
Genome map
AA seq 4261 aa AA seqDB search
MNDRYEAAGNLVEALLQRACEMPRKTALRFIAENVEQPISFRELDERARALAAWMLRHGQ
HGDRAVLLLPSGPDYVAAFFACLYSGIIAVPAYPPESVRPQHLARLRSILDDAQPSLVLT
DSALIEALRPACARANGDSPLLLAVDQADPALAVEWQMPELADDDIAFLQYTSGSTSTPK
GVQVSHGNLMANERLIRHGFGIGDDDVIVSWLPLFHDMGLIGGLLQPIYSGIECVLMSPR
YFLERPRRWLEAIARFGGTVSGGPDFAYRLCCERVNETALEGLDLSKWRVAFSGSEPIRP
DTLERFAAWFAPARFDASSFYACYGLAEATLFVTGGVRGEGIGQLEVDLEALGENIARPG
RGTSLINCGGAQPDHEIQLVDPISGETLGPDRVGEIWSSGPSVALGYWRNPEASARTFVE
KDGRTWLRTGDLGFLHNDELFVTGRLKDMLIVRGQNLYPQDLERCVEEEVDLVRKGRVSA
FAIEHQGREGIGIAAEVGRSVRKLISAEALARAISAAVAETFQEAPLVVALLEPGALPKT
SSGKLQRSVCRTQLLDGSLQAYAIQRAGEPISDGASAKPVAPLSAEEQAIAALWSEVLEL
PAIRRDDNFFALGGNSIKATQLMARLRERLGRAVELRLLFEAPELGAFVAVLAALPTAEA
ESLPLVPRDGRLPLSPAQRRLWFLWKLEPESAVYHIAGRMNLRGELRRPAVEQAFAILLG
RHETLRSRFIEQADGEVSLSLSDATQVELSESDFSSLGNARRDIAAREDADAFAAQPFDL
AHGPLLRLRLQNLGGGRQALLLCVHHIIADGWSLNLLLDEFAECYRAIVEQREPVLPALP
RQYLDLAAAQQGKLEAGEGARLLDWWSERLGNQHSPLELPFTTGEKGQSAELIERDIDAE
LTGKLRSLAQAHGATLSMLLLSAYNLLLQRYSGQHDLRIGLTQAGREQLDSERLVGFFVN
LLVLRSELPEGASLRGVLRQLRDDLLQAQAHQGLPFEQLVEALQPERGHGRHPLCQVAFD
HQWQPRAGNGLPGVSVEALEQLDLETPFDLVLRVREGEQSLRLSFCYARERYAAAGMQRL
VGHFLDLLRALPQMNADAVLDARDWLPAGDWSIAVAADAPAFEALSETIAAQARRHPAKV
ALVDELREVNFAELEDRSNRLAQRLIQRGIGAERRVAVALPRGVDIPLALLAVMKAGGAY
LPLDVDYPEERLAWLMQDAGVDLLLTNAELAERLPLPAGVERLVLEEADLANALAVRPLV
RIQPQNLAYLIYTSGSTGQPKGVAVAHGEIAAHCRAIGQRYAMSEADRELIFMSFAFDGA
HERWLTALSHGGSLLIRNDALWTAEQTLEQLRRHEVTVAAFPPAYLQQLAEQALITGHAP
SMRIYCFGGDAVPEAAYQLAHQALKPQHLINGYGPTETVVTPMLWKADAKTACGAAYAPI
GEVVGERSLYILDDRLQPLPRGVAGELYIGGHGLARGYHQRAGMTAERFVADPFAQGLRA
YRSGDRVRWREDGALDYLGRVDQQVKIRGFRIEPGEIEARLRALPGVREAAVIARDSERG
KRLLGYVVGEALAEDALKAALRSELPEYMVPSRLLVLEQMPLNANGKIDRKALPEPQEAA
STTEAPRDGLESRVAAVWAEVLGVPAVGREDDFFELGGHSLLATQVISRLRRDLGCEVPL
RDLFEASRLDEFAARLTALAPSARPALRAVARDGDLPLSAAQSRLWFFWQMEPASAAYNV
PGALRLRGQLDESALRRAFDALVARHETLRTTFDEVDGQAFQRIQPARPLDLARVDLSAE
KDAEAAARALAETEAQRPFDLRNGPLLRLTLIKLTDADHVLLLTMHHIVSDGWSIRVLVD
EFSRLYGAFAAGEELQLPALPVQYADYAQWQRELLAGEEGQRQLGWWTEQLNRETPVLEL
ATDRPRPAVQSYRGGSLGFSLDAGLGNRLKQLAREQDVTLFMLLLGAYAVLMQRYSGQSD
LRVAVPIANRQQLETEGLIGFFVNTQVMPFALSDDQSFAALLADLKPLALGAQAHQDLPF
EQLVEALQPERSLAYNPLVQVKFNFGFDVSRLPDAGALKLELFSEEQYGARFDLALDMAE
ALDASGQPGDELRGSFVYARDLFDGDSVAAIAGQFEALLRQLCAEPQRALGELPRPVASR
RRGETRQWPQQDVLGLFAAQVAAQPDAIAVQDDSIRYSYAELDQRSNRLANALIASGVEP
GECVAICQERSAQWVLLLLGVLKAGATYVPLDPAQPAERLRQLLQDNGIGRVLVSEPVLR
ETFGAAATLIPAGGPEQGSAAAPGRSIDPQQAAYVIFTSGSTGQPKGVRVSHAALANYVQ
AVLERLQLDQGRARGLGMAMVSSVAADLGHTTLFGALCGGGRLHLADAQAVADAECFAAF
MQDVDVLKIVPSHLAGLLAAAPNAAAVLPRRLLVVGGEACDRALLQPIRELAPKLRVVNH
YGPSESTVGVLTHEWSLLDDLPASTLPIGTPLANSAIRVLDENGRDLLPGVPGELFIGGA
GLALGYLGLPEMTAERFVEIEGERLYRSGDRVRLSRHGVVEFLGRVDDQVKIRGYRVEPG
ELAQALKRLPGVRDAVALAERDNDGPMKLLAWAVTEGQSVESLREGLAAAVPEYLLPAQL
TLLERLPLNANGKVDRQALPRAEAVAKALDSAPLSELEQRIAAIWQAVLKVERVGAEDNF
FELGGDSILSLQIIARIRKLGYKLSPKQLFERQSVRQLAQWLESRAPAAPAAPAPAASVS
GEVALSPVQARFFERVPSAQRHHWNQAVLVQPREALDGDVLARALHWLVGQHDALRLRFD
GSRQRYAEHGPLDMTLLWRRRAADARTLERLCDDAQASLDIANGPLLRAMQVGLEDGSER
LLLVIHHLAVDGVSWRILLEDLQYAYRELRAGRMPAALPRSDSYQAWSARQRAAANGATA
ELGYWQAELRDAPRLTRARSGAPATWKEAANARFSLDVETTRQLLGPALKAQRLQINDLL
LTALARALCAWTGESSALVEMEGHGRDAFDGDAALDLSRSVGWFTALYPVRLHAGGEPGA
DLRATREHLRELPRAGIGYGQLRYLSQHAASLRDLPAPQVTFNYLGQLDQAFADADFLPA
FEGVGRSQPLNAALGNALVYAGRVLGGELSLEVTYSSAMFDAADIDELQALLRAELQALV
AYCLNTPRKLEAAELPLLDLDQQQLDALPLPAGVEDLYPLSPMQQGMLFHALDVPGSSLY
VNQLRVDLEGLDEARFLDAWRAVVARHGNLRTGFLASADAAPLQFVLRDVQLPVQSFDWR
GQQVGEQQLAQTALLDSVADAQRNLGFDLAKPPLQRLALVRLGERRYHLIWTCHHLLLDG
WSSARLIGEVLALYRGEALSAPAAQYGDYIGWLHAQDGAAGERFWRERLKGFDEPTLLAT
ACSAGFREEPLRELHSRLDSAPLQRFAQTQRVTLNTLVQGAWALLLQRYCGQRSVTFGAT
VAGRPATLPGAEESLGLFINTLPILQAPDDAQRVGDWLRELQAFNLDVREFEHTPLYDIQ
RWAGRGGQALFDSIIVFENFPMDAALASSSEDDLRILGHHPVDGTNYALALVASAGEQLD
VRYTYRADRLSSSQIEQLRGHFEHLLLALVEDAERPLGRVSQLADAERNELLQRFNDTEA
KFPADVQLQELIERQVAATPDALALQFGDLRLSYAQLNARANQLAHWLRGQGVGPDVLVG
VAAERSVELVVALLGIVKAGGAYVPMDPDYPQERLQHMLADSGVSLLLTQQHLLERLPAS
DAVMVCLDSQWNEIATASEQNPASAGSPQNLAYLIYTSGSTGKPKGAGNSHRALVNRLHW
MQKAYALDASDRVLQKTPFSFDVSVWEFFWPLMTGAALVVAAPGAHRDPAALRQVIEAGQ
VTTLHFVPSMLQAFVASGELERCSSLLQVICSGEALPYELQQQFCQRSSAKLHNLYGPTE
AAIDVSFWACDEDNARQVVPIGRPIDNLRLVLLDERLEPVPQGVAGELYIGGVGLARGYH
ARPGLTAERFVADPFGSAERLYRTGDLARQREDGAIEYLGRLDHQVKIRGLRIELGEIEA
RLQAHPQVGEAVVVAKDGVLLAYVVASAEPEALRQALQGELPDYMVPSRIILLPAMPLSP
NGKLDRKALPDPQLGDSLREYVAPRSDLEVELAGIWQHVLQVDRVGLHDDFFELGGHSLL
LTQVGLTLRQRLGLELPLHRLFELSNIEALAAWIETQRASTASAEEELDLMDELLGELEN
L
NT seq 12786 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgctacgaagccgcaggaaacctggtcgaggccctgctgcaacgcgcctgc
gaaatgccgcgcaagactgccctgcgattcatcgccgaaaacgtcgagcagcccatcagc
ttccgtgagttggacgagcgcgcccgcgccctggccgcctggatgctgcgccacggccag
cacggcgaccgcgccgtgctgttgctgcccagcggcccggactacgtcgcggcgttcttc
gcctgcctctactcggggatcatcgccgtgccggcctatccgccggagtccgtgcgcccg
cagcacctggcgcgcctgcgctcgatcctcgatgacgcgcagccgagcctggtgctcacg
gattccgcactgatcgaggccctgcgtccagcctgcgcgcgcgcgaacggcgacagcccg
ctgctgctggcggtggaccaggccgatccggcactggccgtcgaatggcagatgccggag
ctggccgatgacgacatcgccttcctgcaatacacctccggctccacctcgacgcccaag
ggcgtgcaggtcagccacggcaacctgatggccaacgagcgcctgatccgccacggcttc
ggcattggcgacgacgacgtgatcgtcagctggctgccgctgttccatgacatgggcctg
atcggcggtctgctgcagccgatttacagcggcatcgagtgcgtgctgatgtcgccgcgc
tatttcctcgaacgcccgcgtcgctggctggaagccatcgcccgtttcggcggcaccgtc
agcggcgggccggacttcgcctaccgcctgtgctgcgagcgggtcaacgaaaccgcgctg
gaaggcctcgacctgagcaaatggcgcgtggccttctccggctccgaaccgatccgtccg
gacaccctggaacgcttcgccgcctggttcgccccggcgcggttcgacgcctcgtccttc
tacgcctgctacggcctcgccgaagcgaccctgttcgtcaccggcggcgtgcgcggcgaa
ggcatcggccagctggaagtggacctcgaagccctgggcgaaaacatcgcccgtccgggc
cgcggcacctcgctgatcaactgcgggggcgcccagcccgatcacgagattcaactggtc
gatccaatcagcggtgaaaccctcggcccggaccgcgtcggtgaaatctggagcagcggc
cccagcgtcgcgctgggctactggcgcaacccggaagccagcgcgcgcaccttcgtcgaa
aaggacgggcgcacctggctgcgcaccggcgacctgggcttcctgcacaacgacgagctg
ttcgtcaccggccgcctcaaggacatgctcatcgtccgtggccagaacctctacccgcag
gacctggaacgctgcgtcgaggaagaggtcgacctggtgcgcaagggccgcgtctccgcc
ttcgccatcgagcaccagggacgcgagggcatcggcatcgccgccgaggtcgggcgcagc
gtgcgcaagctgatctccgccgaagcgctggccagggccatctccgccgccgtggcggaa
accttccaggaggcgccgctggtggtggcgctgctggaaccgggcgcactgcccaagact
tccagcggcaagctgcaacgctcggtatgccgcacccagctgctcgacggcagcctgcag
gcctacgccatccagcgcgccggtgaaccgatcagcgatggcgccagcgccaagccggtc
gcaccactgtctgctgaagagcaagccatcgccgcgctgtggagcgaggtgctggaactg
ccggcgatccgccgcgacgacaacttcttcgccctgggcggtaactcgatcaaggccacc
cagctgatggcgcgcctgcgcgagcgcctgggccgtgccgtggagctgcgcctgttgttc
gaagcgccagagctgggcgctttcgtcgccgtgctggcagcactgccgactgccgaggcc
gaaagcctgccgctggtcccgcgtgacggccggctgccgctgtcgccggcccagcgtcgc
ctgtggttcctctggaagctggaaccggaaagcgccgtgtaccacatcgccgggcgcatg
aacctgcgcggtgaactgcgccggccggcggtggaacaggccttcgcgatcctgctgggg
cgccacgaaaccctgcgcagccgcttcatcgaacaggccgatggcgaggtgtcgctgagc
ctgtccgatgccacgcaagtggaactcagcgaaagcgacttcagttccctgggcaacgcc
cgccgcgacatcgccgcccgcgaggacgccgacgccttcgccgcgcagcccttcgacctg
gctcacggcccgctgctgcgcctgcgcctgcagaatcttggtggcggtcgccaggcattg
ctgctctgcgtgcaccacatcatcgccgacggctggtcgctgaacctgctgctggacgaa
ttcgccgagtgctaccgcgccatcgtcgaacagcgcgagccggtgctgccggcgctgccg
cgccagtacctcgacctcgccgccgcccagcagggcaagctggaggcgggcgagggcgcc
cgtctgctggactggtggagcgagcgcctgggcaatcagcattcgccgctggaactgccg
ttcacgacgggcgagaaaggccagagcgccgagctgatcgagcgtgacatcgacgccgaa
ctgaccggcaaactgcgcagcctggcccaggcccacggcgcgaccctgtcgatgctcctg
ctcagcgcctacaacctgctgctgcagcgctacagtggccagcacgacctgcgcatcggc
ctgacccaggccggccgcgagcagctggacagcgagcgcctggtcggcttcttcgtcaac
ctgctggtgctgcgcagcgagctgcccgaaggcgccagcctgcgcggcgtactccgccag
ctgcgcgacgacctgctgcaagcccaggcgcaccagggcctgccgttcgaacagctggtg
gaagcgctgcaacccgagcgtggccacggccgccatccgctgtgccaggtcgccttcgac
caccagtggcaaccgcgcgccggcaacggcctgccgggcgtcagcgtggaagcgctggaa
cagctcgacctggaaacgccgttcgacctggtgctgcgcgtccgcgaaggcgaacagagc
ctgcgcctgagcttctgctatgcccgcgagcgctacgcggccgccggcatgcaacgcctg
gtcgggcacttcctcgacctgctgcgcgcactgccgcagatgaacgccgacgccgtgctg
gacgcccgcgactggctgcccgccggcgactggagcattgccgtggccgctgacgcgccg
gccttcgaagcgctgagcgagaccatcgccgcccaggcccgccgccatccggccaaggtc
gcgctggtcgacgagctgcgcgaagtgaacttcgccgaactggaagaccgttccaaccgc
ctggcgcagcgcctgatccagcgtggcatcggcgccgaacgccgggtcgccgtggcgttg
ccgcgtggcgtggacatcccgctggccctgctggcggtgatgaaagccggcggcgcctac
ctgccgctggacgtcgattaccccgaggaacgcctggcctggctgatgcaggacgccggt
gtcgacctgctgctgaccaacgccgagctggccgagcgcctgccgctgccggcaggtgtc
gagcgcctggtgctggaagaggccgacctggccaacgcgctggcggtgcgcccgctggtg
cgcatccagccgcagaacctcgcctacctgatctacacctccggttccaccggccagccc
aagggcgtcgccgtcgcccacggcgagatcgccgcgcactgccgcgccatcggtcagcgc
tatgccatgagcgaggccgaccgcgaactgatcttcatgtccttcgccttcgacggcgcc
cacgaacgctggctcaccgcgctgtcccacggcggaagcctgctgatccgcaatgacgcg
ctgtggaccgccgagcagaccctggagcaactgcgccgccacgaagtgacggtcgccgcc
ttcccgccggcctacctgcaacagctggctgaacaagctctgatcaccggtcacgcgccg
agcatgcgcatctactgcttcggcggtgacgcggtgcccgaagcggcctaccaactggcg
caccaggcgctgaaaccgcagcacctgatcaacggctacggccccaccgaaaccgtggtc
accccgatgctctggaaagccgacgcgaaaaccgcgtgcggcgcggcctatgcgcccatc
ggcgaagtggtcggcgaacgcagcctgtacatcctcgacgaccgcctgcaaccgctgccg
cgcggcgtggcgggtgagctgtacatcggcggccacggcctggcccgtggataccaccag
cgcgccggcatgaccgccgaacgcttcgtcgccgacccgtttgcccaaggcctgcgcgcc
taccgcagcggcgaccgtgtgcgctggcgtgaggacggtgcgctggattacctcggccgc
gtcgatcagcaggtgaagatccgtggcttccgtatcgaaccgggcgagatcgaagcgcgc
ctgcgtgcgctgcccggcgtgcgcgaagcggcggtgatcgcccgcgacagcgagcggggc
aagcgcctgctgggctatgtcgtcggcgaagcactggctgaagacgccctcaaggccgcg
ctgcgttcggagctgccggagtacatggtgccgtcgcgcctgctcgtgctggaacagatg
ccgctcaacgccaacggcaagatcgaccgcaaggcgctgcccgagccgcaggaggctgcc
agcaccaccgaagccccgcgcgacgggctggaaagccgcgtcgccgccgtctgggcggaa
gtgctcggcgtgcctgcggtgggccgagaggacgacttcttcgaactgggcggccactcg
ctgctggccacgcaagtgatctcccgcctgcgccgcgacctgggctgcgaagtgccgctg
cgcgacctgttcgaagccagccgcctggacgaattcgctgcacggctgacggcacttgcg
cctagcgcgcgtccggcattgcgcgccgtggcccgtgacggcgatctgccgttgtccgcg
gcccagagccgcctgtggttcttctggcagatggagccggccagcgccgcctacaacgtg
ccgggcgcgctgcgcctgcgcggccagctggacgagtccgcgctacgccgcgccttcgat
gccttggtcgcacgccacgaaaccctgcgcaccaccttcgatgaagtggacggtcaggcc
ttccagcgtatccagccagcccggccgctggacctggcgcgggtcgacctgtctgcggaa
aaagatgccgaggccgccgcgcgtgcgctggctgaaacagaagcccagcgtccgttcgac
ttgcgcaacggcccgctgctacgcctcacgctcatcaagctcaccgacgccgaccatgtg
ctgctgctgacgatgcaccacatcgtctccgatggctggtcgatccgcgtgctggtggac
gagttcagccgcctctatggcgcattcgccgctggcgaggaactgcaactgccggcgctg
ccggtgcagtacgccgactacgcccagtggcagcgtgagctgctggcgggcgaggagggc
cagcgtcagctgggctggtggaccgagcagctcaatcgagagacgccggtactggaactg
gccaccgaccgtccgcgcccagccgtgcagagctaccgtggcggcagcctcggcttcagc
ctggacgccggccttggcaatcgcctaaagcaactggcccgcgagcaggacgtcaccctg
ttcatgctgctgctcggcgcctacgccgtgttgatgcagcgctacagcggccagagtgac
ctgcgcgtcgctgtgcccatcgccaaccgccagcagttggaaaccgaggggctgatcggt
ttcttcgtcaacacccaggtgatgccgttcgccctgtcggatgaccagtcctttgccgcg
ctgctggccgatctcaagcccctggccctgggcgcccaggcgcaccaggacctgcccttc
gagcaactggtcgaagccctgcagcccgagcgcagcctggcctacaacccgctggtgcag
gtgaagttcaacttcggcttcgacgtcagtcgcctgcccgatgccggcgcgctgaagctg
gaactgttcagcgaggaacagtacggcgcgcgcttcgacctcgccctggacatggccgag
gcgctggacgccagcggccagccgggcgatgaactgcgcggcagcttcgtctatgcccgc
gacctgttcgacggggacagcgtcgccgccatcgccggccagttcgaggctctgctgcgc
cagctgtgcgccgagccgcagcgcgccctcggcgaactgccgcgcccggtggcctcgcgc
cgtcgcggtgagacccgccaatggccgcagcaggatgtgctcgggttgttcgccgcgcag
gtcgccgcacagccggacgccatcgccgtgcaggacgacagcattcgctacagctatgcc
gagctggaccagcgcagcaaccgcctggccaacgcgctgatcgccagcggcgtggagccg
ggcgagtgcgtcgcgatctgccaggagcgcagcgcgcagtgggtgctcctgttgctgggc
gtgctcaaggccggcgccacctatgtgccactggacccggcgcagccggccgagcgcctg
cgccagttgctccaggacaacggcatcggccgcgtgctggtgagcgaaccggtgctgcgg
gaaaccttcggcgccgccgccacgctgatcccggccggcggcccggagcagggcagcgct
gccgcgcctgggcggagcatcgacccgcaacaggccgcctatgtgatcttcacgtccggc
tccaccggccagcccaagggcgtgcgcgtcagccacgcggcgctggccaactacgtgcag
gccgtgctcgaacgcctgcaactggaccagggccgcgcccggggtctgggcatggcgatg
gtctcctcggtggccgccgacctcggccacaccacgctgttcggcgcgctgtgtggcggt
ggtcgcctgcacctggcggatgcccaggctgtggccgatgccgagtgcttcgccgcgttc
atgcaggatgtggacgtgctgaagatcgtccccagccatctcgccggcctgctggccgcc
gcgcccaacgctgccgccgtgctgccgcggcgtctgctggtggtcggcggtgaggcctgc
gaccgcgcgctgttgcagccaatccgtgagcttgcgcccaagctgcgcgtcgtcaaccac
tacggccccagcgagtccactgtgggcgtgctgacccacgaatggtcgctgctggacgat
ctgcccgcctcgacactacccatcggaacgccgctggccaacagcgccattcgcgtgctc
gacgagaacggccgcgacctgctgccgggcgtgcccggcgagctgttcatcggcggcgcc
ggcctggcgctgggttacctcggcctgccggaaatgaccgccgagcgctttgtcgagatc
gagggcgaacgcctgtaccgcagtggtgaccgcgtgcgcctgagccgtcacggcgtcgtg
gaattcctcggccgcgtcgacgaccaggtgaagatccgtggctaccgcgtcgagccgggt
gaactggcgcaagcgctcaagcgcctgcccggcgtgcgcgatgccgtggcgctggccgag
cgcgacaacgacggcccgatgaagctgctggcctgggccgtgactgaggggcagagcgtg
gaaagcctgcgcgaaggcctggccgccgccgtgccggaatacctgctgccggctcagttg
acgctgctggaacgcctgccgctgaacgccaacggcaaggtggaccgccaggcgctgccg
cgtgccgaagcggttgccaaggccttggacagcgcgccgctgagcgagctggaacaacgc
atcgccgctatctggcaagccgtgctgaaagtcgagcgcgtcggtgccgaggacaacttc
ttcgagctgggcggcgactccatcctcagcctgcagatcatcgcgcgcatccgtaagctg
ggttacaaactcagcccgaaacagctgttcgagcggcagagcgtccgccagctggcgcaa
tggctggaaagccgcgccccggccgcgccggcagcacccgcgccggcggcttcggtcagc
ggtgaagtggcgctgtcgccggtgcaggcgcgtttttttgaacgtgtaccgagcgcccaa
cgtcaccactggaaccaggctgtactggtgcaaccgcgcgaagctctggacggcgacgtg
ctggcccgtgcgctgcactggctggtcggccagcacgacgcgctgcgcctgcgcttcgat
ggcagccgccagcgctatgccgaacacggcccgctggacatgaccctgctgtggcgtcgc
cgcgccgctgacgcccgcaccctggaacgcctgtgcgatgacgcccaggccagcctggat
atcgccaatggcccgctgctgcgcgccatgcaggtcggcctggaggatggcagcgagcgc
ctgctgctggtgatccatcacctggcggtggacggcgtgtcctggcgcatcctgctggaa
gacctgcagtacgcctaccgcgaactgcgcgccggccgcatgcctgccgcgttgccgcgc
agcgacagctaccaggcctggagcgcccgccagcgggcggctgccaatggcgctaccgct
gagcttggctactggcaggccgaactgcgcgatgcgccgcgtctgacccgcgcccgcagc
ggcgccccggccacctggaaggaagccgccaacgcgcgcttcagcctcgatgtcgagacc
acccgccaactgctcggcccggcactgaaggcgcagcgcctgcagatcaacgacctgctg
ctgaccgcgctggcccgcgccctgtgcgcctggaccggtgaaagctctgcgctggtggag
atggagggccacggccgcgacgccttcgacggcgacgcggcgctggacctgagccgttcc
gtgggctggttcaccgcgctctatcctgtacgcctgcacgccggcggcgagccgggtgcg
gacctgcgcgccacccgcgaacacctgcgcgagctgccgcgcgccggtatcggctacggc
cagctgcgctacctcagccagcacgccgccagcctgcgagacctgccggcgccgcaggtg
accttcaactacctcggccagctcgaccaagccttcgccgacgccgacttcctgccggcc
ttcgaaggcgtgggccgcagccagccgctgaacgccgcgctgggcaatgcgctggtctac
gccggccgcgtgctcggcggcgaactgagcctggaagtcacctacagcagcgccatgttc
gacgcggcggacatcgatgagctgcaagcgctgctgcgcgccgagctgcaagcactggtc
gcttactgcctgaacaccccgcgcaagctggaagccgccgagctgccgctgctcgatctc
gaccagcaacagctcgacgcactgccgctgccggccggggtggaagacctctatccgcta
tcgccgatgcaacagggcatgctgttccacgccctcgatgtgccgggctcttcgctctac
gtcaaccaactgcgcgtcgatctggaaggtctcgacgaggctcgtttcctcgatgcctgg
cgcgcggtcgtcgcccgccacggcaacctgcgcaccggcttcctcgccagtgccgacgcg
gcgccgttgcagttcgtcctgcgcgacgtgcaactgccagtgcagtccttcgactggcgc
ggccagcaggtcggcgagcagcagcttgcccagactgctctcttggacagcgtcgctgac
gcccagcgcaacctcggcttcgacctggccaaaccgccgctgcaacgcctggcgctggtg
cgcctgggcgagcgccgctaccacctgatctggacctgccaccacctgctgctggacggc
tggagcagcgcgcggctgatcggcgaagtgctcgcgctctaccgtggcgaagcactgtcg
gcgccggcggcgcagtacggcgactacatcggctggctgcacgcccaggacggcgcggcg
ggcgagcgcttctggcgcgagcgcctgaagggcttcgacgagccgaccctgctggccacc
gcctgcagcgccggcttccgcgaggagccgctgcgcgagctgcacagccgcctcgacagc
gcgccgctgcaacgcttcgcccagacccagcgcgtcaccctcaacaccctggtgcagggt
gcctgggcgctgctgctacaacgctactgcgggcagcgcagcgtgaccttcggcgccacc
gtggcggggcgcccggccacgctgccgggagcggaagagagcctcggcctgttcatcaac
accctgccgatcctgcaagcgccggatgacgcccagcgtgtgggcgactggctgcgcgag
ctgcaggcgttcaacctcgacgtgcgcgagttcgagcacacgccgctgtacgacatccag
cgctgggccggtcgcggcggccaggcgctgttcgacagcatcatcgtgttcgagaacttc
cccatggatgcggcgctcgcgtcgtccagcgaggacgacctgcgcatcctcggccaccac
ccggtggacggcaccaactacgccctggccctggtggccagcgccggcgaacagctggac
gtgcgctacacctaccgcgccgaccgcttgagctcaagccagatcgaacagctgcgcggc
cacttcgagcacctgctgctggccctggtggaagatgccgagcgcccgctgggccgggtc
agccaactggcggatgccgagcgcaacgaactgctgcaacgcttcaacgacaccgaggcg
aaattcccggccgacgtgcaactgcaggagctgatcgagcgccaggtcgccgcgaccccg
gacgcgctggccctgcaattcggcgatctccgcctgagctatgcccagctcaatgcccgc
gccaaccagctcgcgcactggttgcgtggccagggcgtcggcccggacgtgctggtcggc
gtggccgccgagcgttcggtggagctggtggtggccctgctgggcatcgtcaaggccggc
ggcgcctacgtgccgatggacccggactacccgcaggagcgtctgcagcacatgcttgcc
gatagtggcgtgagcctgctgctgacccagcagcacctgctggaacgcctgccggcaagt
gacgcggtaatggtctgcctggacagccagtggaacgagatcgccacggcctccgagcag
aacccggccagcgccggcagcccgcagaacctcgcgtacctgatctacacctccggctcc
accggcaagcccaagggcgccggcaacagccaccgggcgctggtcaaccgcctgcactgg
atgcagaaggcctacgcgctggatgcctccgaccgcgtgttgcagaagaccccgttcagc
ttcgacgtgtcggtctgggagttcttctggccgctcatgaccggcgccgccctggtagtc
gccgcgcccggcgcgcaccgcgatccggcggcgctgcgccaggtgatcgaggcggggcag
gtcaccacgctgcacttcgtgccgtcgatgctgcaggccttcgtcgcctccggtgaactg
gagcgctgctcgtcgctgctgcaggtcatctgctccggcgaggcgctgccctatgagctg
caacagcaattctgccagcgcagcagtgcgaagctgcacaacctttacggcccgaccgaa
gcggcgatcgacgtcagcttctgggcctgcgacgaagacaacgcgcggcaggtcgtgccc
atcggtcgacccatcgacaacctgcgcctggtgctgctcgacgagcgcctggagccagtg
ccgcaaggcgtggccggcgagctgtacatcggcggcgtaggcctggcgcgcggctaccac
gcgcgccccggcctgaccgccgagcgcttcgtggccgacccgttcggcagcgctgagcgc
ctgtatcgcaccggcgacctggctcgccagcgcgaagacggcgccatcgaatacctcggc
cgtctcgaccatcaggtgaagattcgcggcctgcgcatcgagctgggcgagatcgaggcg
cgcctgcaggcccatccgcaggtcggcgaagcggtggtggtggccaaggacggcgtgctg
ctggcctacgtggtcgccagcgccgagcccgaagccctgcgtcaggcgctgcaaggcgaa
ttgccggattacatggtgccgtcgcggatcatcctgcttcccgccatgccgctgtcgccc
aacggcaagcttgaccgcaaggccctgccggacccgcaactgggcgacagcctgcgcgag
tacgtggcgccgcgcagcgacctggaagtcgagctggccggcatctggcagcacgtgctg
caggtggaccgcgtcggcctgcacgacgacttcttcgaactgggcggccattcgctgctg
cttacccaggtcggcctgaccctgcgtcagcgcctgggcctggaactgccgctgcaccgc
ctgttcgagctgagcaatatcgaggcactggccgcctggatcgaaacccagcgggcaagc
accgccagtgcggaagaggaactggacctgatggatgaactgctcggcgagctggagaat
ctgtaa

DBGET integrated database retrieval system