KEGG   Pseudomonas sp. ATCC 13867: H681_13695Help
Entry
H681_13695        CDS       T02524                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00020  Citrate cycle (TCA cycle)
pdr00480  Glutathione metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
pdr01130  Biosynthesis of antibiotics
pdr01200  Carbon metabolism
pdr01210  2-Oxocarboxylic acid metabolism
pdr01230  Biosynthesis of amino acids
Module
pdr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pdr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H681_13695
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H681_13695
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     H681_13695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: AGI24609
UniProt: M4WXR9
LinkDB All DBs
Position
3091532..3093754
Genome map
AA seq 740 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETRDISLAGRILASFADKLGDQ
AIEDDLAYLAQLATAPEANIIKLPNISASVPQLKGAIAELQKLGYAVPDLPEDPQTDEEN
DTRARYAKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGGD
FFSSEQSVTIPQAGDVRLEFVGKDGKVEVKKTLKMQEGEVLDSMFMSCGKLRDFFEKTLQ
DCKETGVMWSLHVKATMMKISHPIVFGHAVTVYYKDVFDKYGKLFEELGVNPNNGISSVY
DKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSG
QMWGKDGKQKDTKAVMPESTYARMYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEYG
SHDKTFEMEADGTMRVVDADGKVLMQHEVQAGDIWRACQTKDAPIRDWVKLAVTRARQSN
TPAIFWLDPERAHDNELRKKVELYLQDYDLTGLNISIKDYNEAIRTSMERQIRGLDTISV
TGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLRW
DSLGEFLALAVSFEEEGIKTGNAKAKVLSKTLDEATGKLLDNNKSPSRKVGEIDNRGSHF
YLAMYWAQALAAQNDDAELKAHFSALAKTLTEQEATIVAELNGVQGKPADIGGYYRSNPE
LTSQVMRPSATFNAAIDALA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcccttgccacc
tattcgcttcttcccatcgtaaaagccttcgccgcctccgccggcatcgacgtagaaacc
cgcgacatctctcttgcaggccgcatcctggcctccttcgccgacaaactcggcgaccag
gccatcgaagacgacctggcctacctggcccaactggccaccgcccccgaagccaacatc
atcaagctgccgaacatctccgcttcggtaccgcagctcaagggcgccatcgccgagctg
cagaagctgggctacgccgttccggacctcccggaagacccgcagaccgacgaagaaaac
gacacccgcgcgcgctacgccaaggtcctgggcagcgccgtgaacccggtcctgcgcgaa
ggcaactccgaccgccgcgcccccgccgccgtgaaagcctacgcccgcaagcacccgcac
agcatgggcaagtggagcatggcgtcgcgctcccacgccgactacatgcgcggcggcgac
ttcttctccagcgagcagtcggtgaccattccgcaggccggtgacgtccgtctcgagttc
gtcggcaaagacggcaaggtcgaggtcaagaagaccctgaagatgcaggaaggcgaagtc
ctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctgcag
gactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaagatc
tcccacccgatcgtcttcggccacgccgtcaccgtctactacaaggacgtgttcgacaag
tacggcaagctgttcgaagagctgggcgtgaacccgaacaacggcatttccagcgtctac
gacaagatcaagtcgctgcccgcctcgcagcaggaagaaatcctccacgacatccacgag
gtgtacagccaccgcccggaaatggcgatggtcgactcggtcaagggcatcaccaacctg
cacatccccagcgacgtgatcgtcgacgcctccatgccggcgatgatccgcaactccggc
cagatgtggggcaaggacggcaagcagaaggacaccaaggcggtaatgccggaaagcacc
tacgcccgcatgtaccaggagatgatcaacttctgcaagaccaacggcgccttcgacccg
accaccatgggcagcgtgccgaacgtcggcctgatggcacagaaggccgaggagtatggc
tcccacgacaagaccttcgagatggaagccgatggcaccatgcgcgtggtcgacgccgac
ggcaaggtactgatgcagcacgaagtacaggccggcgacatctggcgcgcctgccagacc
aaggacgccccgatccgcgactgggtcaagctggccgtcacccgcgcccgccagtccaac
accccggccatcttctggctggacccggagcgcgcccacgacaatgagctgcgcaagaag
gtcgagctgtacctgcaggactacgacctgaccggcctgaacatcagcatcaaggactac
aacgaagccatccgtaccagcatggagcgccagatccgcggcctggacaccatctccgtg
accggcaacatcctgcgcgactacctgaccgacctgttcccgatcatggagctgggcacc
tcggccaagatgctgtccatcgttccgctgatggccggcggcggcatgtacgagaccggc
gccggcggttcggcgcccaagcacgtacagcagctggtggaagagaactacctgcgctgg
gactccctgggcgagttcctggccctggccgtctccttcgaggaagaaggcatcaagacc
ggcaacgccaaggccaaggtcctgagcaagaccctcgacgaagccaccggcaagctgctg
gacaacaacaagtcgccgtcgcgcaaggttggtgaaatcgacaaccgcggcagccacttc
tacctggcgatgtactgggcccaggccctggccgcgcagaacgacgacgccgaactgaag
gcccacttcagcgcactggccaagaccctgaccgagcaggaagcgaccatcgtcgccgaa
ctgaacggcgtccagggcaagccggccgacatcggcggttactaccgctccaacccggag
ctgacctcgcaggtcatgcgcccgagtgcgaccttcaacgccgcaatcgacgcactggcg
taa

DBGET integrated database retrieval system