KEGG   Pseudomonas sp. ATCC 13867: H681_13975Help
Entry
H681_13975        CDS       T02524                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00020  Citrate cycle (TCA cycle)
pdr00190  Oxidative phosphorylation
pdr00650  Butanoate metabolism
pdr01100  Metabolic pathways
pdr01110  Biosynthesis of secondary metabolites
pdr01120  Microbial metabolism in diverse environments
pdr01130  Biosynthesis of antibiotics
pdr01200  Carbon metabolism
Module
pdr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pdr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H681_13975 (sdhA)
   00650 Butanoate metabolism
    H681_13975 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H681_13975 (sdhA)
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H681_13975 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     H681_13975 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like Thi4 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGI24665
UniProt: M4XH56
LinkDB All DBs
Position
complement(3157548..3159320)
Genome map
AA seq 590 aa AA seqDB search
MASIRSLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVKNQDGHV
VGVIAIDIETGDTVYIRSKAVVLATGGAGRIYASTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQALTTDANGNEQIIEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRATGLH
LEKALKDGIEHRQASESDLESAFKRLNGVNERTSGEEVAPLKRELQSCMQNYFGVFRTGE
YMQKGIAQLADLRERIATVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEARKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVAKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattcgctctctttctttcgacgccatcatcgttggtggcggcggcgccggc
atgcgcgctgcgctgcaactggcccagggcggtcacaagactgccgtggtgaccaaggtc
ttcccgacccgttcgcacaccgtatccgcccagggcggcatcacctgcgccatcgcttcg
gccgacccgaacgacgattggcgctggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgcgatcgaatacatgtgttccgtcggcccggaagccgtgttcgaa
ctggaacacatgggcctgccgttctcccgtaccgagcagggccgcatctaccagcgtccg
ttcggtggtcagtccaaggacttcggcaagggtggccaggctgcccgtacctgcgccgcg
gccgaccgtaccggtcacgccctgctgcacaccctctatcaggccaacctgaagaacggt
acttccttccttaatgagtggtacgccgttgacctggtgaagaaccaggatggtcatgtg
gttggcgtcatcgccatcgacatcgagaccggcgacaccgtttacatccgctccaaggcc
gtggtcctggccactggcggtgccggccgtatctacgcctccaccaccaacgccctgatc
aacaccggtgacggcatcggtatggccctgcgcgctggcgtgccggtgcaggacatcgag
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggttaccgaaggttgc
cgcggtgaaggtggctacctgatcaacgctcacggcgagcgtttcatggagcgttacgct
ccgaacgcgaaagacctggctggccgcgacgtggttgcccgctccatggttaaagaagtg
atcgccggcaacggcgtgggcccgaacaaggaccacgtactgctgaagctcgaccacctc
ggtgaagaagttctgcacagccgcctgcccggcatctgcgaactgtccaagaccttcgcc
cacgtcgatccggtcgtcgctccgatcccggtcatcccgacctgccactacatgatgggc
ggcgtcgccaccaacattcatggccaggccctgaccaccgatgccaacggcaacgagcag
atcatcgaaggtctgttcgccgtaggcgaagtagcttgcgtatcggtacacggcgccaac
cgcctgggcggcaactcgctgctcgacctggttgtgttcggtcgtgccaccggtctgcac
ctggagaaggcgctcaaggatggtatcgagcaccgccaggcttccgaatccgacctggaa
tccgctttcaagcgcctgaacggcgtgaacgagcgcaccagcggcgaagaagtcgctccg
ctcaagcgcgagctgcaatcctgcatgcagaactacttcggtgtgttccgtaccggcgag
tacatgcagaaaggtatcgctcagctggctgatctgcgtgagcgtatcgccaccgtcaag
atcaacgacaagagccaggcattcaacacggcgcgtatcgaagcgctggaactgcagaac
ctcctcgaagtggccgaagccactgcgattgcggcagaagcccgcaaagagtcccgcggc
gcgcatgcccgtgaagacttcgaggagcgcgatgacgagaactggctgtgccacaccctg
tacttcccgggtgagaagcgtgtagccaagcgtgccgtcaacttcgcgccgaaaactgtt
ccggcattcgaacccaaggttcgtacttactaa

DBGET integrated database retrieval system