KEGG   Pseudomonas sp. ATCC 13867: H681_20525Help
Entry
H681_20525        CDS       T02524                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pdr  Pseudomonas sp. ATCC 13867
Brite
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     H681_20525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGI25972
UniProt: M4X4K0
LinkDB All DBs
Position
4590364..4590945
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYAKNALEPHISAETLEYHHDKHHNTYVVNLNNLVPGTEFEGKSLEDIVKTS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFSKTSIGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFSA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgcgaagaatgcccttgagccgcacatttcc
gcggaaaccctggaataccaccacgacaagcaccacaacacctacgtcgtgaacctgaac
aacctggtcccgggcaccgagttcgaaggcaagagcctggaagacatcgtcaagacctct
tcgggcggcatcttcaacaacgcagcccaggtgtggaaccacaccttctactggaactgc
ctgagccccaacggcggtggccagcccaccggcgccctggccgatgccatcaacgctgcc
ttcggttccttcgacaagttcaaggaagagttcagcaagacctccatcggcaccttcggc
tccggctggggttggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggcgccggctgcccgctgaccagcggcgacaccccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtatgtagaagcgttctggaac
ctggtgaactgggacttcgtagcgaagaacttctctgcctga

DBGET integrated database retrieval system