KEGG   Photobacterium damselae subsp. damselae: CAY62_02025Help
Entry
CAY62_02025       CDS       T04927                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAY62_02025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pds01002]
    CAY62_02025
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pds01011]
    CAY62_02025
Enzymes [BR:pds01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAY62_02025
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CAY62_02025
Peptidases [BR:pds01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CAY62_02025
Peptidoglycan biosynthesis and degradation proteins [BR:pds01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CAY62_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Peptidase_S11 Beta-lactamase2 SRP54
Motif
Other DBs
NCBI-ProteinID: ARR48465
UniProt: A0A1X9TY43
LinkDB All DBs
Position
I:complement(456851..458245)
Genome map
AA seq 464 aa AA seqDB search
MFKQLLCVSLLATSLPTLAAFNPQAAIAKLPQGHDLALLIKDPATGKIIYQQRTDNLQAP
ASTQKTITALAAKLYLGDNFRFYTDIEAKGKDIIFNFSGDPTFSRTDLRELLSQIKAKGY
KSIQGNIYLNGSHFTGYERGIGWPWDILGSCYSAPSSSITLEHNCVQGALYTNKGIGNKA
RVNVPSHQPIQVTSTATIVTPSQKKAQFCQLDLISNPNNSYQVSGCSLAYKEPMPLKFAV
QNTTKYTMAVMRQELKRAGISFKGQIYRNDTIKGQRIARNSSKPMSELLDIMLKRSDNLF
ADNIAKTIGAKYYQQPGSYNNGVAAIKEILKTKANIDLSDTIMVDGSGLSRNNRLSANDL
MQVITYIYKHKNLKLFDDFPVAGESGTLRYRKSMRTGELKGKVIAKSGSLFATYNLAGMI
KTKSGKPLLFVQLVTDYHPITKTKGLPPISQFEQKLYQSLYQQY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacaactgctttgcgtatctctcttggcaactagcctacctactcttgccgcc
tttaatccgcaagcggcaatcgcgaaattacctcaaggacatgatttagccctactcatt
aaagatccagcaacgggtaaaattatttatcaacaaagaactgataatctacaagcccca
gccagcacccaaaaaaccattacagccctagcggcaaaactatatcttggtgataatttt
cgtttctataccgatatcgaagctaaaggcaaagatattatttttaactttagtggtgac
cctactttttctcgcaccgatctccgagaactattaagccaaataaaagccaaaggctat
aagagcattcaaggtaatatttatcttaatggcagtcatttcactggatatgagcgcggt
atcggttggccgtgggatattttgggttcttgctacagcgccccatcgagcagtattact
cttgagcacaactgtgtacaaggcgcactctataccaataaaggaattggcaataaagcg
cgggtaaatgtacctagccaccagcctattcaagtgacaagtactgcgactattgttaca
ccaagccagaaaaaagcacaattttgtcagttagatttaatttcaaatcctaataatagc
tatcaagtaagtggttgttcacttgcttataaagagccaatgccacttaaatttgcagtc
caaaataccactaagtacaccatggcagtaatgcgccaagaattaaaacgagcaggtatt
agctttaaaggacaaatttatcgaaatgacacgattaaaggtcaacgtattgcccgtaat
agttcaaaacctatgagcgagctgctcgatattatgctaaaacgctctgataacttattt
gctgacaatatcgctaagaccattggcgctaaatattatcaacagccaggcagttacaat
aatggtgtagctgcaatcaaagaaattctaaaaaccaaagccaatattgatttaagtgac
acgatcatggttgatggttcgggtttatctcgtaataaccgcctaagtgccaatgactta
atgcaagtgatcacttacatatataagcataagaatcttaaattattcgacgatttccct
gttgcaggcgaaagcggtactttgcgttatcgtaaaagtatgagaacaggtgaactgaaa
ggaaaagtgattgcaaaaagtggttcactctttgcgacttataatcttgctggaatgata
aaaacaaaaagtggtaagccattactgtttgttcaattggttacagattatcatccaatc
actaaaaccaaaggactaccacctatcagtcagtttgaacagaaactataccagtcactt
tatcaacaatactaa

DBGET integrated database retrieval system