KEGG   Photobacterium damselae subsp. damselae: CAY62_06285
Entry
CAY62_06285       CDS       T04927                                 

Definition
(GenBank) type VI secretion system ImpA domain-containing protein
  KO
K11910  type VI secretion system protein VasJ
Organism
pds  Photobacterium damselae subsp. damselae
Brite
KEGG Orthology (KO) [BR:pds00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pds02044]
    CAY62_06285
Secretion system [BR:pds02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CAY62_06285
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ARR49216
UniProt: A0A1X9U117
LinkDB
Position
I:1354598..1356046
AA seq 482 aa
MSSMTTYREQLVNPIEGDDAVGLRIIDDPLLDFIDSQMMKVGSLSHADVQWHEVESCVVN
LLSNKTKDIKLLTVLLQCLQHQPTPERFTLSIAVLVDFMSAYWETCHPVAGKRGVLPRKK
FFNQICVRTSSATEKLDGTLFDAELKTTLEALVDELEHQASHYQLPLDLVDDIAAKVRRQ
LSQTPNHAAHQTASQQQMTTSDNHHNSGNSPSPSVSAAPVPKLDIDGSNDRAIRTSLLKV
SDFLSDIGGDGIGLSIRLRRFAVWFSINSLPDANQHGETQLMPVSSDRVSEYEDQLARGG
DLALWRKVEQSLTVSPYWLDGHYLSYRIAKQLGENEWANIIYEELNRFLTRLPQLANLSF
KGKIPFISEPALQWIKDRNTLPNNHKVASVGSWHGKRSEALELAQEGGLSVALAMLNDGL
SQSSEPRDAFYWRLLSADIMKSQHLEAMATEQYQTLYHQAKEMSVTDWEPSLLEQLEQHI
AP
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagttcaatgacaacttaccgagaacaattagttaatccgattgaaggggatgatgcg
gttggccttcggatcattgacgatcctttgttggattttatcgatagtcagatgatgaaa
gtaggatcgctttctcatgctgatgttcaatggcatgaggttgagtcatgtgttgttaat
ttattgagtaataagaccaaagacatcaagcttttgacggttttattacaatgtttacag
catcaaccaacgccagaacgctttaccttatctattgctgtgttagtggattttatgtcg
gcatattgggagacctgtcatcccgttgcaggaaaacgtggcgtattacctaggaaaaaa
ttctttaatcaaatctgtgtacgcacttcaagcgctacagaaaagctagatggtacgtta
tttgatgctgaattaaaaacaacactagaagctttagtggatgagttagagcatcaagcg
tcgcactatcaacttccattggatcttgttgatgacatcgcagctaaagtgcgtcgtcag
ctaagtcaaacgccaaaccatgctgcgcatcaaactgcatctcagcagcaaatgacgact
tccgataatcatcacaatagtgggaactctccatcgccctcggtatcggcagcaccagtt
ccaaaattagatatcgatggcagtaacgatcgggcgattcgcacgtcattgttaaaagta
tcggattttctatcagatataggtggcgatgggatcgggctaagtattcgtcttagacgt
tttgcggtttggttttcgattaatagtttgcctgatgctaatcaacatggcgaaacccaa
ctgatgcctgtctcatctgatcgggtgagtgaatatgaagatcaactagcacgagggggg
gatttagctctttggcgcaaagttgagcaaagcttaaccgtatcaccgtattggttagat
ggtcattatttgagttatcgcattgctaagcaattaggtgaaaacgagtgggcaaatatc
atttatgaagagctaaatcgttttcttacccgattgcctcaattagcaaacctgtcattt
aaggggaaaattccttttattagtgagcctgcgctgcagtggataaaagacagaaatacc
ttaccaaacaatcataaggtcgcttcagttggaagttggcatggcaaacgttcagaggca
ctagagttagcacaagaaggcggtttatctgttgctttggccatgcttaatgacggtctc
tctcaatcgagtgagccaagagatgccttttattggcgtttgctttctgccgatatcatg
aaaagtcagcatttagaggctatggcgacagaacagtatcagaccttatatcaccaagca
aaggaaatgtcggtaaccgattgggaaccgtctttgttagaacaacttgagcagcatatt
gccccttag

DBGET integrated database retrieval system