KEGG   Photobacterium damselae subsp. damselae: CAY62_11315Help
Entry
CAY62_11315       CDS       T04927                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00250  Alanine, aspartate and glutamate metabolism
pds00410  beta-Alanine metabolism
pds00430  Taurine and hypotaurine metabolism
pds00650  Butanoate metabolism
pds01100  Metabolic pathways
pds01110  Biosynthesis of secondary metabolites
pds01120  Microbial metabolism in diverse environments
pds02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAY62_11315
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAY62_11315
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAY62_11315
   00430 Taurine and hypotaurine metabolism
    CAY62_11315
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CAY62_11315
Enzymes [BR:pds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CAY62_11315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARR50071
UniProt: A0A1X9U2N3
LinkDB All DBs
Position
I:2442831..2444231
Genome map
AA seq 466 aa AA seqDB search
MAIHEVNHEQGADPIFGSDALSHIASSKKMPQQEQSPQAIYQMIRDELYLDGNARQNLAT
FCQTWEEDEVHKLMDLSIDKNMIDKDEYPQSAEIENRCVHILADLWNSPDSVTTIGTSTT
GSSEACMLGGLAALWRWRAKRQAEGQPTDKPNMVCGPVQVCWEKFARYWDIEMRQTKMDD
GHYMMTPEDMLELVDANTIMVVPTFGQTFTGLYETVKPLSDALDTYEHDTGNSIDIHVDG
ASGGMLAPFCATDIEPWDFRLERVKSISTSGHKFGLAPVGCGWVVWRSKEDLPEGLIFHV
NYLGGDMPTFALNFSRPAGQIIAQYYDFLRLGYEGYQRIHNSSYDVCRYLVQELNKFDLF
EFIFDGNPKKGIPAISWRLKDHANVSFSLYDLADRLRTRGWLVPAYSLPANAQNIVVQRI
LVKQGFSQDLANLLIKDFTRSIEFLQTHGTTKCSEADVKSFDHSGR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctattcatgaagttaaccatgaacaaggcgcagaccctatttttggatccgatgca
ctttctcatattgcctctagcaaaaaaatgcctcagcaggagcaatctccacaagctatc
tatcaaatgattcgagacgaactctatcttgatggtaatgctcgtcaaaacctagcaacc
ttctgccaaacttgggaagaagatgaagtacataaattgatggatctttctatcgataag
aacatgatcgacaaagatgaataccctcaatctgctgaaattgaaaaccgctgtgttcat
attctagcggatttatggaattcacctgattcagttacgaccattggtacttcaacaacc
ggttcaagtgaagcgtgtatgttaggtggtttggccgctctttggcgttggcgagcaaaa
cgtcaggctgaaggtcaaccaactgataagccaaatatggtatgtggtccagtacaagtc
tgttgggaaaaatttgcccgttactgggatattgaaatgcgtcaaaccaaaatggatgat
ggtcactatatgatgacacctgaagacatgttggagcttgttgatgccaatactattatg
gttgtcccaaccttcggtcaaacctttacgggtctatatgaaactgtaaaaccattgtct
gatgcacttgatacttacgagcacgatactggtaactctattgatattcacgttgatggt
gccagtggtggtatgttagcaccattctgcgctactgatattgagccatgggatttccgt
ctagagcgtgtaaaatctatcagcacctcaggccataaattcggtttagctcctgtcggt
tgtggttgggttgtttggcgtagtaaagaagatcttcctgaaggtttgattttccacgtg
aactatttaggcggagacatgccaactttcgcattgaacttctctcgccctgccggacaa
atcattgctcaatactatgattttcttcgtctaggctacgaaggttaccaacgtatccac
aattcaagctatgacgtatgtcgctacctagtacaagagctcaataaattcgatctcttc
gagtttatttttgatggtaaccctaaaaaaggtatccctgctatctcatggcgattaaaa
gatcatgcgaatgtttcatttagcctatacgatcttgcagatcgactacgtacccgtggt
tggttagtgcctgcttatagcttacctgccaacgcacaaaatattgtggtgcaacgtatt
ttggttaaacaaggattctcacaagaccttgcaaatctactcattaaagacttcactcgc
agcatcgagtttctacaaactcacggtacaactaaatgcagtgaagccgatgtaaaatca
tttgatcatagtggtcgctaa

DBGET integrated database retrieval system