KEGG   Photobacterium damselae subsp. damselae: CAY62_13225Help
Entry
CAY62_13225       CDS       T04927                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00620  Pyruvate metabolism
pds00680  Methane metabolism
pds01100  Metabolic pathways
pds01120  Microbial metabolism in diverse environments
pds01200  Carbon metabolism
Module
pds_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAY62_13225
  09102 Energy metabolism
   00680 Methane metabolism
    CAY62_13225
Enzymes [BR:pds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CAY62_13225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARR50763
UniProt: A0A1X9U4P7
LinkDB All DBs
Position
I:2803998..2806628
Genome map
AA seq 876 aa AA seqDB search
MNEKYSALKSNVSMLGHLLGNTIKDAHGEELLNKVETIRKLSKSARAGNSDDRAKLINEL
QNLPDDELLPVARAFSQFLNLTNIAEQYHTVSRHCETSVCSPDSIDGLFTQLEQGDISQF
DTINAIRNLKIDLVLTAHPTEIARRTMIHKLVQINKCLSKLELSELSSAERQRVETRLEQ
LIAQAWHSDVIRQQRPTPLDEAKWGFAVVENSLWQAVPDFLRQFDDKLEAHIGEGLPIDA
APVTFSSWMGGDRDGNPFVTSQVTREVLLLSRWKAADLYLKDIQELVSELSMVKCNEQVR
ALAGDEHEPYRAILKNLRSQLTHTRDILDAQIKGQSVALLPIISDESQLWDPLYACYQSL
HECGMGIIADGLLLDTLRRIKCFGIHLVRLDIRQESTRHSDVISELTRYLGLGDYDQWSE
QDKVAFLVRELSSKRPLLPRHWQPSPEVQEVIDTCKTIAKQPKDALGAYVISMARTASDV
LAVHLLLQEAGCPFRMDVCPLFETLDDLNNGADVIEQLLNIDWYRGFIQNHQMVMIGYSD
SAKDAGVMSAGWAQYRAMEKLVDVCEKAGVELTLFHGRGGTIGRGGAPAHAALLSQPPRS
LKGGLRVTEQGEMIRFKLGLPEVAVNSLSLYASATLQANLLPPPAPKQEWCELMDSLSEV
SCKAYRDVVRGNPEFVPYFRAATPELELGKLPLGSRPAKRNPTGGVESLRAIPWIFAWSQ
NRLLLPAWLGAGEAIQNSIDQGHTELLEEMCREWPFFSTRLGMLEMVFTKTNVGIAQYYD
QRLTDEALWPLGQKLRDQLQQDIKTVLTVENNDHLMEQDPWGAEAIRLRNIYVEPLNMLQ
AELLYRNRQQQESSPIMEEALMVTIAGIATGMRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacagtgcgttaaaaagtaacgtcagtatgttgggacacctgttgggt
aacaccatcaaagatgcccacggtgaggagttacttaataaagtagaaaccattcgaaaa
ttgtcaaaatctgctcgcgcaggcaatagcgatgatcgtgctaaattgatcaatgagctt
cagaatctacctgatgatgaattacttcctgtcgctcgtgcttttagccaatttttaaac
ctcacgaatattgctgaacaataccatacggtttctcgccactgtgaaaccagtgtttgc
agcccagactcaattgatggactctttacccagttagagcaaggtgacatcagccagttt
gataccattaatgccattcgcaatcttaaaattgatttggttttaaccgctcaccctaca
gagattgctcgccgtaccatgatccataaactggtgcaaatcaataaatgtctatcaaaa
ttagaactcagtgaactttcttctgccgagcgtcaacgcgtcgaaactcgtcttgaacaa
cttattgctcaagcatggcattccgatgtcattcgtcagcagcgcccaacccctcttgat
gaagcaaaatggggctttgcggtagtagaaaattcactctggcaagccgtaccagacttc
ctgcgccaatttgatgataagttggaagcacacatcggtgaaggcttacccattgatgca
gctcctgtgacattttcatcatggatgggtggtgaccgcgacggtaacccatttgtgacg
tcacaagttacccgtgaagtactgcttctttctcgctggaaagcagccgacctctacctt
aaagatatccaagagctcgttagcgagctctctatggttaagtgtaacgagcaagttcgc
gcacttgctggggatgaacacgaaccataccgagcgatcttaaagaaccttcgttcacag
ttgactcacactcgcgatatcctagacgctcagatcaaaggacagagtgttgccctgcta
ccgattatttcggatgaatcacaactttgggatcctctgtatgcctgctaccagtctctg
catgagtgcggtatgggtattattgctgatggtttactgctggataccctacgccgtatt
aagtgttttggtattcatctggttcgtcttgatattcgccaagaaagtactcgccactca
gatgtaatttcagagttgactcgctatcttggtttgggtgattacgatcagtggagtgaa
caagataaggttgcattccttgttcgtgaactctcatcaaagcgccctcttctgcctcgt
cattggcagccatcgcctgaagtacaggaagtgatcgatacttgtaaaacgatcgccaaa
caacctaaagatgcgctaggtgcttatgttatttcgatggcacgtactgcatcggatgta
ctggccgtacacctactgctacaagaagctggctgtccatttagaatggatgtctgccca
ttatttgagaccttagatgacttaaataatggcgcagatgttattgagcagcttcttaat
atcgactggtaccgtggctttattcaaaaccatcaaatggtcatgattggttattcagac
tcagctaaagatgcgggtgttatgtctgcgggttgggctcaatatcgcgccatggaaaaa
ttggttgatgtatgtgaaaaggctggcgttgaactgactctattccatggccgtggcggc
acaattggtcgaggtggagctcctgctcatgcggctctattatctcaaccaccacggagc
ctaaaaggtggattgcgcgtcactgagcaaggggaaatgatccgctttaagttaggatta
ccagaagtagcagtgaatagcttaagcctgtatgccagtgcaacactgcaagctaactta
ctaccacctccagcgccgaaacaggaatggtgtgaattaatggattcactttctgaggta
tcttgtaaagcatatcgtgatgtggtccgcggcaatcctgagtttgtcccttacttccgc
gcagcaacgcctgaactggaactgggtaaattacctcttggttctcgacctgccaaacgt
aatccaacgggtggcgttgaaagtttacgtgcgattccatggatctttgcttggagtcag
aaccgtttactgcttcctgcttggcttggcgctggtgaagcgattcaaaactctatcgat
caaggccacactgaattgcttgaagaaatgtgccgtgaatggccattcttctcaacacgt
ttgggtatgctagaaatggtatttaccaaaaccaatgttggtatcgcacagtactacgat
caacgactcaccgatgaagcgttatggccattaggacaaaaactgcgcgatcaattacag
caagatattaaaacggttcttactgtagaaaataacgatcacctgatggagcaagatcca
tggggcgctgaagcgattcgtttgcgtaacatctatgttgaaccattgaacatgctgcag
gctgaattactataccgtaaccgccagcaacaagagagcagtccaataatggaagaggca
ttaatggtgaccatagcaggtattgctaccgggatgcgtaacactggttga

DBGET integrated database retrieval system