KEGG   Photobacterium damselae subsp. damselae: CAY62_14080Help
Entry
CAY62_14080       CDS       T04927                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00071  Fatty acid degradation
pds00280  Valine, leucine and isoleucine degradation
pds00281  Geraniol degradation
pds00310  Lysine degradation
pds00362  Benzoate degradation
pds00380  Tryptophan metabolism
pds00410  beta-Alanine metabolism
pds00640  Propanoate metabolism
pds00650  Butanoate metabolism
pds00903  Limonene and pinene degradation
pds00930  Caprolactam degradation
pds01100  Metabolic pathways
pds01110  Biosynthesis of secondary metabolites
pds01120  Microbial metabolism in diverse environments
pds01130  Biosynthesis of antibiotics
pds01200  Carbon metabolism
pds01212  Fatty acid metabolism
Module
pds_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CAY62_14080
   00650 Butanoate metabolism
    CAY62_14080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAY62_14080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAY62_14080
   00310 Lysine degradation
    CAY62_14080
   00380 Tryptophan metabolism
    CAY62_14080
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAY62_14080
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CAY62_14080
   00281 Geraniol degradation
    CAY62_14080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAY62_14080
   00930 Caprolactam degradation
    CAY62_14080
Enzymes [BR:pds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CAY62_14080
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CAY62_14080
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CAY62_14080
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CAY62_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF5101
Motif
Other DBs
NCBI-ProteinID: ARR50525
UniProt: A0A1X9U416
LinkDB All DBs
Position
I:2975305..2977485
Genome map
AA seq 726 aa AA seqDB search
MIYQGETLYVDYIEPGIAELCLHASGSINKFDLATLESLNQALNALYQQPDLKGLLLTSS
KDSFIVGADITEFLGLFALSEPELLQWLNYANSIFNKLEDIPVPTVSAISGYALGGGCEC
VLACDFRIGTPTTKIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITTGKEQTASQALK
MGLLDAIVDTENLHQSALNLLHNAIDTTINWQPRRSQKQQPLALNHTEALMSFTTAKAMV
AKLAGPHYPAPMMAVKTIENAAQLSRAEALQIESTNFVKLAKSSEAQALIGLFLGDQKLK
AAAKKATKESSLIEHSMVLGAGIMGGGIAYQSAVKGIQVTMKDIAPASLDLGMTEVAKLL
NKRLERGRIDGLKMAQILGRINPTLSYPQQAPQIIVEAVVENPKIKMAVLQEVEAATPAT
TVLTSNTSTIPIDLLAQGLTRPEQFCGMHFFNPVHKMPLVEIIRGKATSEQTIQQVVSYA
KQMGKTPVVVNDCPGFFVNRVLFPYFAAFSQLVNDGIDFQRIDKIMERQFGWPMGPAYLL
DVVGIDTAHHAQAVMAEGYPDRMAKAHKDAIDVLFENKRFGQKNGSGFYNYQLDKKGKPK
KTRAPEVTQLLNSLCQQPLDLSDQQIMERMMIPMINEVVLCLEQHIIAAPADGDMALIYG
LGFPPFIGGVFRYLDNLGLDNYLRLTKQYQQLGALYSVPSSLQEMAKKQQIYYPKPNSTL
NLHTQG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggtgaaaccctctatgtggactacattgaacccggtattgctgaactg
tgtttacatgcttcaggctctatcaataaattcgatctcgccacattagaaagcttaaac
caagccctcaacgccctatatcaacaacccgacctcaaaggtcttttacttacctcaagc
aaagacagctttattgttggggctgatatcacagaatttctcggcctctttgcactatca
gaaccagagctgttgcaatggttgaattacgctaacagtatttttaataagcttgaagat
atccccgtgcctactgtgtctgccatctccggttatgcattaggtggtgggtgtgagtgt
gtattggcttgtgattttcgtatcggcaccccaacaaccaaaatcggtctacctgaaacc
aaattggggatcatgccagggtttgggggaaccgtgcgtttacctcgcttaattggtgct
gatagcgcaatggaaatcatcaccacaggaaaagagcaaacagcatctcaagcgctaaaa
atgggcctccttgatgctattgtggatacagaaaatctccatcaatcggcgctcaatttg
ctgcacaatgccattgatactacgattaactggcaacctcgccgtagtcaaaaacagcaa
ccactcgcgttaaaccataccgaagcactgatgagctttaccacagcaaaagccatggtt
gccaagctagcaggcccccactatcccgcacctatgatggcagtaaaaaccattgaaaat
gcggcgcaactcagccgagcagaagcactgcagattgagagcacaaactttgtaaaacta
gcgaaatccagtgaagctcaagcattaattgggctctttttaggagatcaaaaacttaaa
gcagcagctaaaaaagccactaaagaaagtagcttaattgaacatagcatggtgctaggt
gcaggtattatgggaggaggtattgcctatcagtctgcggtgaagggcatccaagttacc
atgaaagatattgcgccagcatcgctagatttagggatgacagaagtcgcaaaattactc
aataagcgcctagagcgaggccgcattgatgggctgaagatggcacaaattctaggtcgt
attaacccaaccttatcttatccacaacaggcacctcagatcatagttgaagcggttgtt
gaaaatcccaaaattaaaatggcagtattacaggaagttgaagcagctactcccgccaca
accgtactgacatctaatacttcaaccataccgattgatctgttagcgcaaggattaact
cgtccagaacaattttgtggcatgcatttcttcaatccagtacataagatgcccttagtt
gaaattattcgtggaaaggccacttcagaacaaaccattcagcaagtggtcagctatgct
aaacagatggggaaaacgcctgttgtcgtcaatgattgccctggatttttcgttaaccgc
gtcctgtttccttactttgccgcttttagccaattggttaatgacggcattgattttcag
cgtattgataaaattatggaacgccaatttggttggcctatgggtccggcttacttatta
gatgttgtcggtattgatactgcccatcatgcccaagcggtaatggccgaagggtatcca
gatcgaatggctaaagcacacaaagatgctattgatgtgctgtttgaaaataaacgtttt
ggacaaaaaaatggttctggattctataactatcaattagataaaaaagggaaaccgaag
aaaactcgagctcccgaagtcactcaattactcaactctctttgccaacaaccactcgat
cttagcgatcagcagatcatggaacgtatgatgatcccaatgatcaatgaagtcgttctg
tgtctggagcagcacattattgccgctccagccgatggggatatggcgctcatttatggt
ttaggatttcctccatttattggaggggttttccgctacctcgataacttaggcttagat
aattacttgcgcctcaccaagcaatatcagcaactgggggctctttactcagtacctagc
agtttgcaagagatggcgaaaaaacaacaaatctactatccgaaaccaaacagcacactg
aatttacacactcaaggatga

DBGET integrated database retrieval system