KEGG   Photobacterium damselae subsp. damselae: CAY62_15515Help
Entry
CAY62_15515       CDS       T04927                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pds  Photobacterium damselae subsp. damselae
Pathway
pds00550  Peptidoglycan biosynthesis
pds01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pds00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAY62_15515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CAY62_15515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pds01011]
    CAY62_15515
Enzymes [BR:pds01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAY62_15515
Peptidoglycan biosynthesis and degradation proteins [BR:pds01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CAY62_15515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer GP3_package
Motif
Other DBs
NCBI-ProteinID: ARR50892
UniProt: A0A1X9U5A2
LinkDB All DBs
Position
II:151209..153167
Genome map
AA seq 652 aa AA seqDB search
MTKTTRTPFRDHTAEVRLFGRRAIFSFAAIIILMGVLIGNLYHLQVQDYSEYKARSNDNR
IKIIPVAPNRGRIFDRNGVLLAENVPIYSLDLYPSKIKDLKQTLAGLQKLLGITDEQIAA
FYKEKRHTSHYKPVTLIEQMTETQVAEFSVNEFHYPGVDVDAYLERYYPYGAQLTHVLGY
VAKINDRDIQRLKDEGVYSNYKATHTIGKLGVERYYESLLHGKSGYEKVEVDSRGRVVRT
LSYVPPVSGKDIMLTIDLGLQEYANQLLTQQVKDPITGKMVTKPRRGSIVVLDPKDNSVL
AMASSPSYDPNLFVHGISSKNYRALLNNPDHPLLNRATLGVYPPGSTVKPEIAVAALTTG
VITPQTTYDFPGWWQIPNAKTTRKFRDDVRWGHGRVNIYKAIEESVDTFFYQVAYDMGID
RLSTWMKKFGYGQPTGIDIREETNGNMPTREWKHARFKVPWYQGDTIPVGIGQGYWTATP
MQIAKAASVIAESGVEHRPHLLKGIVEENDKVDDAEFPDFPKVVAPKQNWQIAQEGMHLV
TVSGTARSIFKNIAYPVAGKTGTSQVFTLADNQNYNAKDIAEHLRDHALFVGFAPVQNPK
VLVATVLENGGWGKNAAPLAKKIMDYVLLKPTLNPASSDNTANDKSVKTTMS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaactacacgtacgccttttcgagatcacactgctgaagtccgactttttggc
cgaagagccattttctctttcgcggcaatcattattttaatgggagtcttgattggtaac
ttgtatcatctgcaagttcaagactatagcgaatataaagctcgctcaaatgataaccgc
attaaaatcattcctgttgcacctaaccgggggcgaatttttgaccgtaatggcgttttg
ctcgcagagaatgtacctatctattccttggatctttacccatcaaaaattaaagatctc
aagcagacattagcaggacttcaaaagctgttagggataacagatgaacaaattgccgct
ttctataaagagaaacgtcacaccagtcactacaagcctgttacgttaattgagcagatg
acagagacgcaagtggccgaattttctgttaacgaattccattatccaggtgttgatgtt
gacgcatatttagaacgttattacccatatggcgcacaattaacgcacgtacttggctat
gttgcgaaaattaatgatagagatattcagcgcctaaaagatgaaggggtatacagtaac
tacaaagcaacccatacgatcggaaagttgggtgtagagcgttactatgaaagtcttctg
cacggtaaatctggctatgaaaaagtcgaagtggacagtcgtggtcgtgttgttcgaacg
ttgtcttatgttcctcctgtatcggggaaagatattatgctcactatcgatcttggccta
caggaatacgccaatcaattactgacccagcaagtaaaagatcctattactggaaaaatg
gtaacgaaacctcgccgtggttcgattgttgttcttgatcctaaggataactcggtgctg
gctatggcatcgagtcctagttacgatcctaatttgtttgtacatggaatctcatctaaa
aattatcgagcactattaaataaccctgatcacccgttgctgaaccgagccacacttggt
gtttatcctccaggctctacagttaaacctgaaattgcagtagcggcattaacaactggg
gtaattacgccccaaacgacctatgatttccctggctggtggcagatccctaacgcgaaa
accacacgaaaattccgtgatgatgtgcgctggggtcatggtcgcgtaaacatttataaa
gccattgaagagtcggttgatactttcttctatcaggttgcttatgatatggggatagac
cgattatccacttggatgaaaaaatttggttatggtcaaccaaccggtattgatattcgt
gaagagaccaacggaaatatgccaacgagggagtggaagcatgctcgttttaaggtgcca
tggtatcaaggcgatacgattcctgttggtattggacaaggctattggacagcaacacca
atgcagattgcaaaagccgcgtcagttattgccgaaagtggtgttgagcatcggccacat
cttctaaaaggaattgtggaagagaatgataaagttgatgatgcagagtttcctgatttt
ccaaaagtagttgcgcctaaacaaaattggcagattgctcaagagggaatgcatctggta
actgtaagtggtacagcaagaagtatatttaagaatattgcttatcccgttgctggtaaa
acaggtactagtcaggtatttactttggccgataaccagaattacaacgcgaaagatatt
gctgaacatctacgagatcacgctttatttgttggatttgctcctgtgcagaaccctaag
gtattagttgcaaccgtgctggaaaatggtggctggggtaaaaatgcagcgccactggct
aagaaaattatggattatgtattgttaaaaccaacattaaatccagcatcatctgataac
actgcgaacgataaatccgtgaaaacaaccatgagttga

DBGET integrated database retrieval system