KEGG   Prevotella dentalis: Prede_1112Help
Entry
Prede_1112        CDS       T02403                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pdt  Prevotella dentalis
Pathway
pdt00500  Starch and sucrose metabolism
pdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Prede_1112
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Prede_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AGB28440
UniProt: F9D2F0
LinkDB All DBs
Position
1:complement(1392320..1394449)
Genome map
AA seq 709 aa AA seqDB search
MRLHLFIASLLCSAAALGQEVSSPDGNVRLRFSLTAAGQPTYEMSYKGWAVVKPSHLGLE
LAKDSHASKGMRETSLMDGFTETAHRTTTFDETWKPVWGETATIRNHYNELAVDLAQPSS
KRTMTIRFRVYDDGMGLRYEFPQQDSLVYFVIKDEHTQFAMTGDHTAWWLPGDYDTQEQE
TQESRLSEIRTRFHDAVNWSNSSVSVFSPTGVQTSLQMKSRDGLYINIHEAACVDYATMH
LNLDDKNLVFDSWLTPDATGMKGYMQTPCQTPWRTVMVSDDARDMLSSNLILNLNEPCKI
EDTSWIHPTKYCGVWWEMIVGKSSWNYTDEFPSIKLDQIDWSKAKPNGRHAANTAKVKQY
IDFAARNGLQQVLVEGWNVGWEDWANHWKQDVFDFVTPYPDFDLKALNDYAHSKGVKLMM
HHETSSSVQNYERHMERAYQLMNRYGYDAVKSGYVGDIIPRGDHHYSQSMNNHYLYCVKE
AARHHIMVNAHEATRPTGLCRTWPNLVGNESARGTEYEAFGGSQPNHTVILPFTRLQGGP
MDYTPGILETQLKTWSDNPNYVHTTLVGQLALYLVMYSPLQMAADLPENYAKYDDAFQFI
RDVACDWDDSRYLEAEPARYITVARKAKGTDNWFVGGKCDEHGHQSTVKLDFLDNGRCYD
CTIYADAKGADYEKNPKAYTITRRTVKHGDVLKLTEARGGGFAVSLMAK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttacatctgttcattgcatccctcctgtgctcggctgcagccctgggccaggag
gtgagttcgcccgacggcaacgtcaggctcaggttctcgctcacggccgccggccagccc
acctacgagatgagctacaagggctgggccgtggtgaagccctcgcacctggggctcgag
ctggccaaggacagccatgcctccaagggcatgcgcgaaaccagcttgatggacggcttc
accgagacggcccatcgcaccacaaccttcgatgagacgtggaaacccgtgtggggtgag
acggccaccatccgcaatcactacaacgaactggccgtggacttggcccagccttcgtcc
aagcgcaccatgaccatccgctttcgcgtgtacgatgacggcatggggctgcgctatgag
ttcccccagcaggactcgctcgtttactttgtcatcaaggatgagcacacgcaattcgcc
atgacgggcgaccataccgcctggtggctgcccggagactacgacactcaggagcaggaa
acccaggaaagccgcctctcggagatacgcacccgcttccatgatgccgtgaattggagc
aactcttcggtgtcggtgttctcacctaccggcgtgcagacgtcgctgcaaatgaagagt
cgcgatggcctttacatcaatattcacgaggctgcctgcgtggactatgccacgatgcac
ctcaatctggacgacaagaacttggtgttcgactcgtggctcacgcccgacgccaccggc
atgaaaggctacatgcagacgccctgccagacaccctggcgcacggtaatggtgagcgac
gatgcgcgcgacatgctttcgagcaacctcatcctcaatcttaacgagccgtgcaagatt
gaagacaccagctggatacaccccacgaagtactgtggcgtgtggtgggagatgattgtg
ggcaagagttcgtggaactataccgacgagttcccctccatcaagctcgaccagatagac
tggagcaaggccaaacccaacggccgccacgccgccaacacggccaaagtgaagcagtat
atcgactttgctgcccggaacggcttgcagcaagtgctcgtcgagggctggaatgtgggc
tgggaagactgggctaaccactggaaacaggatgtgttcgactttgtgacgccctatcct
gacttcgaccttaaggcgctgaatgactatgcccacagcaagggcgtgaagctgatgatg
caccacgagacctcgtcgagcgtgcaaaactacgagcgacacatggagcgtgcctaccag
ttgatgaaccgctacggctacgacgcggtgaagagcggctatgtgggcgacatcatcccg
cgcggcgaccaccactattcccagtccatgaacaaccattatctctactgcgtgaaggag
gcggcccggcatcacatcatggtgaacgcccatgaggccacgcgtcccacgggtctttgc
cgcacgtggcccaacctggtgggcaacgaaagcgcccgcggcacggaatatgaagccttt
ggcggcagccagcccaaccacacggtcatcctgcctttcacccggcttcagggcggcccc
atggactacacgcccggcattctggagacgcagctcaagacttggagcgacaatcccaac
tacgtgcacaccacgctcgtgggccagctggccctgtatctggtgatgtacagcccgttg
cagatggccgccgacctgcccgagaactatgccaaatacgacgatgccttccagttcatc
cgtgacgtggcctgcgactgggacgactcccgctatctggaagccgagcctgcgcgctac
atcacggtggcacgcaaggccaagggcacggacaactggtttgtaggaggcaagtgcgac
gagcacggccaccagagcacggtgaagctcgacttcctcgacaacggccgttgctacgac
tgcaccatctatgccgacgccaaaggggccgactatgagaagaatcccaaggcctatacc
attactcgcaggacggtgaaacacggcgacgtgctgaagctcaccgaggcgcgcggcggc
ggctttgccgtgtcgctgatggcgaagtaa

DBGET integrated database retrieval system