KEGG   Prevotella dentalis: Prede_1697Help
Entry
Prede_1697        CDS       T02403                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pdt  Prevotella dentalis
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Prede_1697
Enzymes [BR:pdt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Prede_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored FAD_binding_2 Thioredoxin_3 DAO Thi4 AlaDh_PNT_C NAD_binding_8 Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGB28996
UniProt: F9D4U7
LinkDB All DBs
Position
2:complement(248812..250371)
Genome map
AA seq 519 aa AA seqDB search
MLDTNIIEQLRGIFGVLENRFELRVTADEAHEHAAEMRDFVNDFCSTSEHLSASFDGSRA
GRLEFELLKNGEETGVKFRGIPNGHEFTSLIMAVVNADGKGKNLPDDAICRRIRSLKGDI
RLQTYVSLTCTNCPDVVQALNLMAILNPRMSSEMVDGALFEEEVSRLNIQAVPSVYANGE
QLHIGRGDLGVLLQKLEDRFGSELDESREVVEREFDVVVLGGGPAGTSAAIYSARKGLRV
ALVAGRIGGQVKDTVGIENLISVPKTTGAQLADDLRKHLYNYPVEVFDNRKIDTVDLAGS
RKRVHVKGGEVFLSPAVIIATGANWRKLNVDDEARYIGHGVHFCPHCDGPFYKGRHVAVV
GGGNSGVEAAIDLAGICSKVTLLEFGEELRADTVLQEKLASLPNVEAFTMAQTTRVLGNG
ENVTALRVKDRNTDQEREIAVDGVFVQIGLAANSDPFRDHLPLNARKEIEVDAFCRTSVP
GVYAAGDVTNVPFKQIVIAMGEGAKAALSAFDDRIRGVI
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgttagacacaaacattatagaacagttgagaggcattttcggcgtgctcgaaaatcgc
tttgagctgcgtgtgacggccgacgaggcccatgagcatgcggcagagatgagggatttt
gtcaacgatttctgttcgacctccgagcatctgtcggcttctttcgacggaagtcgggcg
ggccgtctggagtttgagctgctcaagaacggcgaggagacgggcgtgaagttccgcgga
atacccaacggccacgagttcacctcgctcatcatggccgttgtcaatgccgacggcaag
ggaaagaatcttcccgacgatgccatttgccggcgcatacgctcgctcaagggcgacatc
cggctgcaaacctacgtttcgctcacctgtaccaactgccccgacgtggtgcaggccctc
aatctcatggccattctcaacccgcgaatgagcagtgagatggtggatggggcactcttc
gaggaggaagtgagccgccttaacatccaggccgtgccgtcggtctacgccaacggcgag
cagttgcacatcggccggggcgacctcggcgtgctcttgcagaagctggaagaccggttt
ggaagcgagttggacgagagccgggaggtggtggagcgcgagttcgacgtggttgtgctc
ggcggaggccctgccggaacgtcggccgccatctattcggcccgcaagggactgcgggtt
gcactcgttgccggacgcatcggaggccaggtaaaagacaccgtgggcatagaaaatctc
atctccgtgcccaagaccaccggggcgcaactggccgatgacctgcgcaagcacctctac
aattatcccgtggaagtgttcgacaaccgtaagatcgacactgtagaccttgccggcagc
cggaagcgcgtgcacgtgaaggggggcgaggtgttcctctcgccggccgtcatcatcgcc
acgggggccaactggcgcaagctgaacgtggacgacgaggcccgttacatcggccacggc
gtgcatttctgtccgcattgcgacgggcctttctacaaaggcaggcatgtagccgtggtg
ggcggaggcaactccggcgtggaggcggccatcgatttggccggcatctgctctaaggtg
acgcttctggagtttggcgaagagcttcgcgccgacaccgtgttgcaggagaagctggcc
tcgctgcccaatgtggaggcgttcaccatggcgcagaccacgcgcgtgctgggcaacgga
gaaaacgtgacagccctgcgtgtgaaagaccgcaacaccgaccaggagcgcgagatagcc
gtcgacggcgtgtttgtacagattggtctggctgccaacagcgaccctttccgcgaccat
ctgccgctcaacgcccgcaaagagatagaggtagacgctttctgccgcacgtccgttccc
ggtgtttatgccgccggcgacgtcaccaacgtgcctttcaagcagatcgttatcgccatg
ggcgagggcgccaaagccgccctttcggctttcgacgaccgaatcagaggtgtgatttga

DBGET integrated database retrieval system