KEGG   Prevotella dentalis: Prede_2705Help
Entry
Prede_2705        CDS       T02403                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pdt  Prevotella dentalis
Pathway
pdt00473  D-Alanine metabolism
pdt01100  Metabolic pathways
pdt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Prede_2705
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Prede_2705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pdt01011]
    Prede_2705
Enzymes [BR:pdt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Prede_2705
Peptidoglycan biosynthesis and degradation proteins [BR:pdt01011]
 Precursor biosynthesis
  Racemase
   Prede_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AGB29930
UniProt: F9D487
LinkDB All DBs
Position
2:1433783..1436260
Genome map
AA seq 825 aa AA seqDB search
MTYTIEKVTTLIGARRYGDRDANVGFLLTDSRSLCFPEETLFFALKSQRNDGHNYIPELY
RRGVRNFVVADVPAGYAVDYPEANFLRVVNTLEALQRLAERHRDEFNIPIVGITGSNGKT
MVKEWLYQLFSPGLHVTRSPRSYNSQIGVPLSVWLMDEQTQVGIFEAGISEPGEMLALRD
IIQPTIAVLTNLGAAHQENFDSMEDKCREKLMLFHDAETVVYHADDENVARVVAEFRSKG
ERLCWSTQDRRAPLFVKSVAKGEGSTTVTYIYKGGAEASYSIPFIDDASIVNSIVCAAVA
LHLGLDARQLAERMPQLEPVAMRLEVKEGRHGCTLINDSYNSDINSLDIALDFMNRRPDH
KGRRRTLILSDIFQSGDEPERLYKEVSDLARKRGVVKFIGIGPVLSAHADEIQLSEKFFF
STVESFIRSEVFRSLRDEVILLKGARQFGFDRITELLVQKVHETVLEVNLNAVVKNLNHY
RSFMHPETKLVCMIKADAYGAGSIEIAKTLQDHRVDYLAVAVADEGAMLRGNGITSNIMI
MNPELSAFKTMFDYDLEPEVYSFRLLDALIRAAEKEGITGYPVHVKLDTGMHRLGFDPEH
DMDELIGRLHRQNAIIPRSVFSHFVGADSDGFDEFSARQFQLFDKASRRLQAAFDHKILR
HIDNSAGIEHFPERQLDMCRLGLGLYGIDSRDNSIINNVSTLKTTILQLREVKAGDTVGY
SRKGAIARDSLIAAIPIGYADGLNRHLGNRRGYCLVNGQRAEYVGNICMDVAMIDVTGIA
CQEGDSVEIFGDHLPVTELSTALDTIPYEVLTGISNRVKRVYFQD
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaccattgaaaaagtaaccacactcatcggagcacgccgttatggcgaccgc
gatgccaacgtgggcttcctgcttaccgacagccgttcgctctgctttcccgaggagacg
ctgttcttcgccctgaagtcgcagcgcaacgacggtcacaattacatccccgaactctac
cgacgcggtgtccgcaacttcgtcgtggccgatgttccggccggttatgccgtggactat
cccgaagccaacttcctgcgggtggtcaacacactggaggccttgcagcggttggccgag
cgccaccgcgacgagttcaacatccccattgtgggcatcacgggctccaacggcaagacc
atggtcaaggagtggctctaccagctgttctcgccggggcttcatgtgacgcgcagcccg
cgcagttacaactcccaaataggcgtgcccctgtctgtttggctcatggatgagcagacg
caggtgggaattttcgaggccggaatcagcgagcccggcgagatgttggccctgcgcgac
atcatccaacccaccattgccgtgctcacaaacctgggtgcagcccatcaggaaaacttc
gattcgatggaggacaagtgccgcgagaagctgatgctcttccatgatgccgagactgtg
gtgtatcacgccgacgacgaaaacgtggcccgcgtggtggccgaattccgcagcaagggc
gagcgtctctgctggtccacgcaggatcggcgggctccgctgttcgtcaagtcggtggcg
aaaggggagggcagcaccaccgtcacctatatatataaaggtggggcggaggccagttac
agcattcctttcatcgacgacgcctccatcgtgaactccatcgtgtgcgccgccgtggcc
ctgcacctgggactggacgcccggcagctcgccgagcgcatgccgcaactggaacctgtg
gccatgcgtctggaggtaaaggagggccgccatggctgcacgctcatcaacgattcctat
aattcagacatcaactcgctcgacatcgccctcgacttcatgaaccggcgacccgaccac
aagggccgtcggcgcacgctcatcctgagcgacatcttccagagcggcgacgagcccgaa
cggctctacaaggaagtgagcgacctggcccgcaagcgcggcgtggtgaagttcatcggc
ataggccctgtgctctccgcccatgccgacgagatacagctttccgagaaattcttcttc
tccaccgtggagtcgttcatccgcagcgaggtgttcaggagcctgcgcgacgaggtgatt
ctgctcaagggcgcacgccagttcggcttcgaccgcatcaccgagctccttgtgcaaaag
gtgcacgagaccgtgctcgaggtgaatctcaacgctgtggtgaagaacctgaaccactac
cgctccttcatgcaccccgaaaccaaactcgtgtgcatgattaaagccgacgcctacggg
gccggaagcatcgagattgccaagaccctgcaggatcatcgcgtggactatctggccgtg
gccgtggccgacgagggagccatgctgcggggcaacggcatcacgagcaacatcatgatt
atgaaccccgagctctcggctttcaagaccatgttcgactacgacctggagcccgaggtc
tactctttccgcctgctcgatgccctgatacgcgccgccgaaaaagaaggcatcaccggc
taccccgtacacgtcaagctcgacacgggcatgcaccggctgggcttcgatcccgagcac
gacatggacgagctcatcggccgtctgcaccgccagaacgccatcatcccgcggtcggtc
ttctcccatttcgtgggggccgacagcgacggtttcgacgagttctcggcccgtcagttc
cagcttttcgacaaggccagccggcggctgcaggccgctttcgaccacaagatactgcgg
cacatcgacaattcggccggcatcgagcactttcccgaacgccagctcgacatgtgccgc
ctgggattgggcctctatggcatcgacagccgcgacaacagcatcatcaacaacgtgtct
acactgaagaccaccatcctgcaactgcgcgaggtcaaggcgggcgacaccgtgggctac
agccgcaagggtgccattgcccgcgacagtctcatcgcggccatccccataggctatgcc
gacggactgaaccgacacttgggcaaccgccgcggttactgcctggtgaacgggcagcgg
gccgaatacgtgggcaacatctgcatggacgtggccatgatcgacgtgaccggcattgcc
tgtcaggagggcgacagcgtggaaatcttcggcgaccatctgcctgtcaccgagctgagc
accgccctcgacaccatcccctacgaagtgctcactggcatcagcaaccgtgtcaagcgc
gtctacttccaggattga

DBGET integrated database retrieval system