KEGG   Paenibacillus durus: PDUR_12780Help
Entry
PDUR_12780        CDS       T03297                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pdu  Paenibacillus durus
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdu01001]
    PDUR_12780
Enzymes [BR:pdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PDUR_12780
Protein kinases [BR:pdu01001]
 Serine/threonine kinases: Other
  Bacterial family
   PDUR_12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Haspin_kinase Kdo FTA2 Pkinase_fungal KIND YrbL-PhoP_reg Seadorna_VP7 PIP49_C Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AIQ12680
UniProt: A0A089HPM0
LinkDB All DBs
Position
2876554..2878758
Genome map
AA seq 734 aa AA seqDB search
MIGHELGGRYQVIERIGGGGMALVYRAHDILLNRNVAIKVLRNQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMEYVEGKNLNEIIKERAPLQVDEAVRIATQICDA
LDHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVATGEKSDLYSLGIVIYQMLTGSLPFLGESPISVALKHLQEEFEEPRKLNPMIPQSV
ENIILKSMRKNPEERYQSAKEMLQDLETCLLPERRSEQKVSFMDDDEDRTRVMPAIKPIP
RSNGLRSRGEDRMIREDDPPSAKKKKDWGRPALWIGLTLLLLLAMAGVVWYVNAKLVVPE
VTVPKLVSLSLDDAKVKLADAGLVLEEPVTTEYNANFAEGIVFEQSKEPDTTVKEGTTIA
LKVSIAKPLLSMPELSGMTYDEAVEALVAQGVEQSRITQDSEFSKEIPEGEVLRQNPISG
SQYDPDTAAISITVSKGQESITMPDLTGLSESEAKAKLEELGLELGDVKRESSFSIEKGK
ITKQWPYEKGAAAQPGEKITLYISDGYPPEALEYTFNLPVSPVQEGKKTKIRIEFVDARN
NGEKQDWGTRTISKTQVLSVNLILAPNKEGAVMVYQDGEFFDTYSVSYMDAKNGTVPIPE
PSPVNPPSPSPAATPAGTEPSADPVTAPGTEGATPDTGGEPGVNQTGDSASGTQIISGND
NQDTTSKHKGKDKK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcacgagttgggaggccgttaccaagtcatcgagcggatcggtgggggcgga
atggcgcttgtatatagggcacatgatattctgctcaatcgaaatgtcgctattaaagta
ttgcggaaccaatttgtacatgatgaggaatttattcgccggtttcggcgggaagcgcaa
tctgctgcatcgctttctcatcccaatgtggttagcatttacgacgtgggacaggaagat
gaaattcattatatagttatggaatacgtggaaggcaagaatctgaacgaaattatcaag
gagagggcgccgctacaggtggacgaagccgtgagaatcgccacccaaatctgtgacgcg
ctcgatcatgcccatcagaatcagattatccatcgggatatcaaaccgcataacatactt
atcgggcgtaacggccgtgtcaaagtgaccgatttcggcatagcccgcgccgtaacgtcg
actacgattacacagaccggttcggtcgtcggttcggtgcactatttttctccggaacat
gccaagggagtcgccacaggtgaaaaatcggatttgtattcactcggcatcgtgatctat
caaatgctgaccggcagcctgccttttctgggcgagagtccaatcagcgtagcgctgaag
catcttcaagaggaatttgaggagccgcgcaagctgaatccgatgatcccccaaagcgtg
gagaacatcatccttaaatcaatgcgcaaaaatcctgaggagcgctatcaatcggctaaa
gaaatgctacaggatctggaaacctgtctgctgccggagcgccggagcgaacagaaggta
tcattcatggatgatgatgaggacagaaccagggtgatgccggccatcaagccgattccc
aggagcaacggcttgcgcagccgcggcgaggatagaatgatccgtgaggacgatcctccg
tctgccaagaagaaaaaagattggggaagacccgcactgtggatcgggcttacgctgctg
ctcctgctggcgatggccggggtggtgtggtatgtaaacgcgaagctggttgttcctgaa
gtaacagtccccaaactagtcagtctttcgctggacgatgcgaaagtcaagctggccgat
gcgggacttgttctggaggagccggtaacgacggagtacaatgctaactttgctgaaggg
atcgtcttcgagcagagcaaagagccggatacgacggtaaaagaaggaacgaccatcgcg
cttaaggtaagcattgccaaaccgctcctgtcaatgccggagttatccgggatgacttat
gacgaagcggtggaagctttggtagcgcaaggtgtagagcagagccgaataacacaggac
agcgaattcagcaaagaaattccggaaggtgaggtactccggcagaatccgatttcaggc
agccaatatgatccggataccgctgctatctcgatcacagtcagcaaaggccaggagagc
atcacgatgccggatttaacgggcctctccgaatcggaagcgaaagccaagctggaggag
ctaggtctggagctcggtgatgtgaagagggaatccagcttttccatagaaaagggcaag
ataacgaagcaatggccgtatgaaaaaggcgcagcggcgcaacctggcgagaaaatcacc
ttatatatcagcgacggctatccgcctgaagcgctggaatacacgttcaaccttccggta
tctccggtgcaggaagggaagaagaccaagatccggatcgaatttgtcgatgcgcgcaac
aatggcgagaaacaggattggggaacccgcacgatcagcaaaacccaggtactgtcggtg
aaccttattctcgctccaaataaggaaggggctgtcatggtgtaccaggatggagagttc
ttcgatacgtattccgtctcgtacatggatgcaaagaacggtacggtgccaattcccgag
ccttcgccggtcaatccgccatcgccgtctccggccgcgacgcctgccggcaccgaaccg
tctgcagatccggtaaccgcgcccggaacggaaggcgctacgccagataccgggggcgag
ccaggcgtcaatcagacgggggacagtgcgagcggtacgcagatcatatcaggtaatgac
aatcaggacaccacttccaaacataaaggtaaagataagaaataa

DBGET integrated database retrieval system