KEGG   Paenibacillus durus: PDUR_13125
Entry
PDUR_13125        CDS       T03297                                 

Definition
(GenBank) glucan 1,6-alpha-glucosidase
  KO
K01215  glucan 1,6-alpha-glucosidase [EC:3.2.1.70]
Organism
pdu  Paenibacillus durus
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PDUR_13125
Enzymes [BR:pdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.70  glucan 1,6-alpha-glucosidase
     PDUR_13125
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Other DBs
NCBI-ProteinID: AIQ12742
UniProt: A0A089HNQ9
LinkDB
Position
2940752..2942380
AA seq 542 aa
MTVGNNKWWKETVVYQIYPRSFQDTNGDGIGDLKGIISRLDYLAELGIGAIWLSPVCKSP
QDDNGYDISDYQDIDPMFGSLQDMETLINESKKRNIRIVMDLVLNHSSDEHPWFLEAKKS
KDNPYHDYYVWRDGVEGTPPNDLRSCFGGSAWEWVPELGQYYLHLFSVRQPDLNWDNPKV
RQEIYDMINWWMDKGVGGFRLDVIDLIAKEPDRKITANGPNLHKYIQELSRETFQKGDLL
TVGETWGATPEIAKLFSNPDGSEFSMVFQFEHIMLDEQEGKGKWDLAPLDFLKLKQVLSK
WQTELKGEGWNSLFWNNHDLPRIVSRWGNDGEYRVESAKMLATLLHGMHGTPYIYQGEEL
GMTNVHYPIEDFRDIELLNLYKERIESGYAHEDIMESIYAKGRDNARTPMQWDASEHAGF
TAGQPWIRVNPNYTEINAAGELENPDSIFHYYKKLIRLRKENNVIVYGDYKLLFPEDKEL
FGYTRTLGETTLLVLCNFYGNTVSYEIPEELAGEKELLISNYSDEVSAGTLRPYEARMYL
LK
NT seq 1629 nt   +upstreamnt  +downstreamnt
ataacagtgggaaataataaatggtggaaagaaacggtagtctatcaaatctaccctcgg
agctttcaggatacgaacggagacggcatcggagacctgaaaggaattatctccagactg
gattatttggcggagcttggaatcggtgccatctggctttctccggtatgcaaatcgccc
caggatgacaatggctacgatatttccgattatcaggatatcgatccgatgttcggttcg
cttcaggacatggagacgctgattaacgagtccaagaaacgaaacatccgaattgtcatg
gatcttgtgctgaaccactcgtccgacgagcatccttggtttctcgaagcaaagaaaagc
aaggacaatccgtatcatgattactatgtctggagagacggggtggaaggaacgccgccc
aacgatttgcgaagctgctttggcgggtccgcgtgggagtgggtgccggagctggggcag
tattatttgcatctgttctctgtgaggcagccggacctcaactgggataatcccaaagtc
cggcaggagatttacgatatgatcaactggtggatggataagggagtgggcggtttccgg
ctcgatgtaatcgacctgatcgccaaagagcccgaccggaaaatcaccgccaacggcccg
aatcttcacaagtatattcaagagctcagcagggaaacttttcaaaagggagatctgctg
acggtaggcgaaacctggggcgctactccagagatcgccaagctgttcagcaatccggat
ggcagtgaattctccatggtgttccagttcgagcatatcatgctggatgagcaggaaggg
aaagggaagtgggatcttgcgccgctggatttcctgaaattaaagcaggtgctgtccaaa
tggcagacggagctgaagggcgaaggctggaacagcctgttctggaacaaccacgatctg
ccgcgcattgtctcccgctggggaaatgacggagaataccgcgtggagtcggccaaaatg
ctggccaccctacttcatggcatgcatggcaccccttacatttatcagggtgaagagctg
ggcatgacgaatgtgcactatcctattgaggatttccgcgacatcgagctgcttaaccta
tacaaagagcggatcgaaagcggatacgcccacgaagatattatggagtcgatttacgcc
aaaggccgcgacaatgcgcgtacgccaatgcagtgggatgcttccgaacatgcgggattt
acagcgggccagccttggattcgggtcaatccgaattacacggagatcaatgcggcgggc
gaattggagaatccggactccatatttcattattataagaagctgattcggctccgcaag
gaaaataacgtaatcgtttacggcgactacaagctgctgttccctgaagataaggaattg
ttcggttatacccgcacgctgggtgagaccacgctgctcgtgctgtgcaatttttatgga
aataccgtttcatatgaaatacctgaagagctggctggagaaaaggagttgctgatctcc
aactacagcgatgaagtttccgccggtacgctgcgtccttacgaagcaagaatgtacctg
ctcaaataa

DBGET integrated database retrieval system