KEGG   Paenibacillus durus: PDUR_26285Help
Entry
PDUR_26285        CDS       T03297                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pdu  Paenibacillus durus
Pathway
pdu00500  Starch and sucrose metabolism
pdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PDUR_26285
Enzymes [BR:pdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PDUR_26285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AIQ14991
UniProt: A0A089HSL1
LinkDB All DBs
Position
5727937..5729472
Genome map
AA seq 511 aa AA seqDB search
MKRNHTMMQFFEWHVAADGEHWKRLARLAPELKAAGIDSVWIPPVTKGQSAEDTGYGAYD
LYDLGEFDQKGTVRTKYGTKQELIDATAECLRHGITVYVDLVMNHKAGADETEVFRVVEV
DPGNRLKVISGPFEIEGWTKFNFPGRGNEYSSFKWNFEHFNGTDYDAKKGRTGIFKIIGE
NKDWNRNVDHEFGNYDYLMFANIDYCHPVVRSEMLEWGKWLVDTLQCGGYRLDAIKHINY
DFIREFAAEMTRKRGEDFYIVGEFWNPDLEACRQFLDTVDYQIDLFDVALHYKFQAASLG
GRNFDLTTIFHDTLVQTHPTNAVTFVDNHDSQPHESLESWVGDWFKPSAYALILLRLDGY
PVVFYGDYYGIGGPSPIDGKREAIDRLLSARYHKAYGEQNDYFDHPNTIGWVRQGVDEIP
GSGCAVVVSGGDDGEKRMFVGTKRAGETWTDLTLSREDTVVIGKDGWAVFPVNGGGVSVW
ALPVEQPAGDVSALENILEADNREEAETSEN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaatcatacgatgatgcagttttttgaatggcatgtggccgccgacggcgaa
cactggaagcgtctggcaaggctggcgccggagctgaaagcggccggaatcgactctgtc
tggattcctccggtgacgaagggccaatccgccgaagacaccggatacggagcatacgat
ctgtacgaccttggggaattcgatcaaaagggcaccgtccggacgaagtacggcacgaag
caggaactgatcgatgcgactgcggaatgtctgcggcacggcattacggtctatgttgat
ctggtcatgaaccataaggctggcgcggatgaaacagaggtgttccgggtcgtcgaggtt
gatccaggcaaccgcctgaaggtcatatcgggaccgttcgaaatcgaaggctggacgaaa
tttaatttcccgggacgcggcaacgaatattcttcgtttaaatggaatttcgagcatttc
aatggtacggactatgacgccaaaaaagggcggacaggcatcttcaagatcatcggcgag
aataaggactggaaccgcaatgtagaccacgagttcggaaactacgattatctgatgttc
gccaatatagattattgccatcctgtcgtccgctccgaaatgctggaatggggaaaatgg
ctcgtcgatacgcttcagtgcggcggctaccgcctggatgcgatcaagcatatcaactat
gatttcatcagggaatttgcggcggaaatgacccgcaaacgcggggaagacttctatatt
gtcggcgaattctggaacccggatcttgaggcctgccgccagtttctggatacggtcgat
tatcagatcgacctgttcgatgtggcgctccactacaaatttcaggccgcctcgctcggg
ggcaggaacttcgatctgacgactattttccatgacacgctggtgcagacgcatcccacc
aatgccgtcacttttgtcgacaaccatgattcccagccccatgaatcgctggagtcctgg
gtcggcgactggttcaagcccagcgcatatgcgctgatcctgctaaggctggacggctat
ccggtagtattctacggcgactattacggcatcggcggaccgtcgccgattgacggcaaa
cgcgaagcgatcgaccggctgctgtccgcccgctaccacaaagcctacggggagcagaac
gattacttcgaccacccgaatacaatcggctgggttcgacagggcgtggatgaaattccg
ggctcgggctgcgcggtcgtcgtatcgggcggagacgacggcgagaagcgcatgttcgtc
ggaacgaagcgcgccggggagacctggaccgatctgacgctaagccgggaagatacggta
gtgatcggcaaagacggatgggccgtctttccggtaaacggcggcggcgtgtccgtatgg
gcgctgccggtggagcagccggccggggacgtaagcgccttagaaaatatccttgaggcg
gataacagagaggaagcggagaccagcgagaactaa

DBGET integrated database retrieval system