KEGG   Pseudonocardia dioxanivorans: Psed_2046Help
Entry
Psed_2046         CDS       T01479                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00250  Alanine, aspartate and glutamate metabolism
pdx00410  beta-Alanine metabolism
pdx00430  Taurine and hypotaurine metabolism
pdx00650  Butanoate metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx02024  Quorum sensing
Module
pdx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Psed_2046
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psed_2046
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psed_2046
   00430 Taurine and hypotaurine metabolism
    Psed_2046
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Psed_2046
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Psed_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AEA24271
UniProt: F4CY30
LinkDB All DBs
Position
complement(2178280..2179680)
Genome map
AA seq 466 aa AA seqDB search
MPLHDRDTVRDELDDCVFVDRDLTRPVTKYRFPQEESLPRDVSQLVSDELMLDGNARQNL
ATFCQTWVEPEVMGLMALSVSKNMIDKDEYPQTAEIERRCVHMMADLWNAPEAANTVGAS
AIGSSEACMLAGMAAKWRWRAKRRAAGKPVDNPNMVCGPVQVVWHKFARYWDIEMREVPM
APGSYAMDAASMLERVDENTIMVVPTLGVTYTGAYEPVADMALALDQLQADTGLDVDIHV
DAASGGFLAPFCAPDLAFDFRLPRVKSISASGHKFGLAPLGVGWVVWRGAGELPDDLVFH
VNYLGGDMPVFQINFSRPAGQIVASYYNFLRLGREGYRRIHDASYDVGQYLAAEIVKLGP
FELLCDSRPDTGIPTVTWRIREGEDPGYTLYDLADRLRTKGWQVPAYTLTGTASDIAVQR
ILVRLGVSRDMASLLLDDFRDAVAHFGKHPVTIPMTKQESGGFSHL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgctacacgaccgcgacaccgtccgcgacgagctcgacgactgcgtcttcgtcgac
cgcgacctgaccaggcccgtcaccaagtaccggttcccgcaggaggagagccttccgcgg
gacgtctcccagctggtgtccgacgagctgatgctcgacggcaacgcgcgccagaacctg
gccaccttctgccagacgtgggtcgagcccgaggtgatgggcctgatggcgctgtcggtc
agcaagaacatgatcgacaaggacgagtacccgcagaccgccgagatcgagcggcggtgc
gtgcacatgatggccgacctgtggaacgcgcccgaggcggccaacaccgtcggcgcctcg
gcgatcggctcgtcggaggcgtgcatgctggcggggatggccgccaagtggcggtggcgg
gcgaagcggcgggcggccggcaagccggtggacaacccgaacatggtgtgcggcccggta
caggtggtgtggcacaagttcgcccggtactgggacatcgagatgcgcgaggtcccgatg
gcccccgggagctacgccatggacgcggcctcgatgctcgaacgggtcgacgagaacacg
atcatggtcgtgccgacgctcggcgtcacctacaccggtgcgtacgagccggtggccgac
atggcgctcgccctcgatcagctgcaggccgacaccggcctcgacgtcgacatccacgtg
gacgccgccagcggcggtttcctcgccccgttctgcgcgcccgacctggccttcgacttc
cggctcccgcgggtgaagtcgatcagcgcctccggacacaagttcgggctcgcaccgctc
ggtgtcggctgggtcgtctggcgcggcgccggcgagctgcccgacgacctggtgttccac
gtcaactacctgggcggcgacatgccggtgttccagatcaacttctcccggccggccggg
cagatcgtcgcgagctactacaacttcctccggctcgggcgcgagggctatcgccgcatc
cacgacgcgtcgtacgacgtcggccagtacctcgccgccgagatcgtgaagctcggcccg
ttcgagctgctgtgcgacagcaggcccgacaccggcatcccgacggtcacgtggcggatc
cgcgagggcgaggaccccggatacaccctgtacgacctggccgaccggctgcgcaccaag
gggtggcaggtgcccgcctacaccctcaccgggaccgcctcggacatcgcggtccagcgc
atcctggtccgcctcggcgtcagccgcgacatggcctccctgctgctcgacgacttccgg
gacgccgtcgcccacttcggcaagcacccggtcacgattcccatgacgaagcaggagtcg
ggcgggttcagccacctctga

DBGET integrated database retrieval system