KEGG   Pseudonocardia dioxanivorans: Psed_4718Help
Entry
Psed_4718         CDS       T01479                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
pdx  Pseudonocardia dioxanivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C CDC48_2
Motif
Other DBs
NCBI-ProteinID: AEA26865
UniProt: F4D177
LinkDB All DBs
Position
5053537..5054607
Genome map
AA seq 356 aa AA seqDB search
MDLPVMPPVKPMLAKPVAAIPDGRHYEPKWDGFRSIIFRDGDEVEIGSRNERPMTRYFPE
VVEAVKANFPERAVIDGEIVVVDRERNRLDFEALQQRIHPADSRVRLLAEQTPASFVAFD
LLALGDDDLTGSRLDERRATLERVLGDAKPPVHITPATQDPVLAEQWFREFEGAGLDGLI
AKPLDLTYQPDKRVMAKIKHERTCDCVVAGYRVHKSGPDAIGSLLLGLFDERGVLASVGV
VGAFPMARRRALFTELQPLVTEFEGHPWNWAAHELGERTPRKNEGSRWNAGKDLSFVPLR
PERVVEVRYDYMEGLRFRHTAQFVRWRDDRTPESCTYEQLEQPVSFDLGDVLGLPD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctggccaagcccgtcgccgcgatt
cccgacggcaggcactacgagccgaagtgggacggcttccggtcgatcatcttccgcgac
ggcgacgaggtcgagatcggcagccgcaacgaacggccgatgacccggtacttccccgag
gtcgtcgaggccgtgaaggccaacttcccggagcgcgcggtgatcgacggggagatcgtc
gtcgtcgaccgggagcgcaaccggctcgacttcgaggccctgcagcagcgcatccacccc
gccgactcacgcgtccggctgctcgccgagcagaccccggcgagcttcgtggcgttcgac
ctgctcgccctcggcgacgacgacctcaccggttcacggctcgacgagcgccgcgcgacg
ttggaacgcgtcctcggcgacgcgaaaccgcccgtccacatcacccccgcgacgcaggac
ccggtgctggccgagcagtggttccgcgagttcgagggcgcggggctcgacgggttgatc
gccaagccgctcgacctcacctaccagcccgacaagcgggtcatggccaagatcaagcac
gagcgcacgtgcgactgcgtggtggcgggctaccgcgtccacaagtcgggccccgacgcg
atcggctcgctgctgctcggcctcttcgacgagcgcggcgtgctggcctccgtcggcgtc
gtcggcgcgttcccgatggcccggcgccgcgcgctgttcacggagctgcagccgctcgtc
accgagttcgagggccacccgtggaactgggccgcccacgagctgggcgaacgcaccccg
cgcaagaacgagggcagccgctggaacgcgggcaaggacctgtcgttcgtgccgctgcgt
cccgagcgggtcgtcgaggtgcgctacgactacatggaggggctgcgcttccggcacacc
gcgcagttcgtccgctggcgcgacgaccggacgcccgagtcgtgcacctacgagcagctc
gaacagccggtcagcttcgacctcggcgacgtgctggggctgccggactga

DBGET integrated database retrieval system