KEGG   Pseudonocardia dioxanivorans: Psed_4989Help
Entry
Psed_4989         CDS       T01479                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Psed_4989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pdx03400]
    Psed_4989
Enzymes [BR:pdx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Psed_4989
DNA repair and recombination proteins [BR:pdx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Psed_4989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEA27127
UniProt: F4CNA3
LinkDB All DBs
Position
complement(5342976..5345027)
Genome map
AA seq 683 aa AA seqDB search
MPARRPDAALRPMLATPGRPPSGPGWAVEFKWDGVRALLDVDDAGEVHLTSRNGNDVTLG
YPDLLAGVDTGQPLVLDGEIVALDEAGRPDFGLLQNRMHVRHPSGPLLAEVPVRFYAFDV
LRVGQRSLLRETYDDRRAALAGLGVDGWARFAVPPSTTEVPPAQMLDVAREHGLEGIVAK
RRTSRYEPGRRAASWVKTALFTTREVVLGGWTPGQGRRGALGSLLLGAYDDEGRLHYLGN
VGSGFSEAALRSLREKLEQLRSDEDPFASGVPREHARGVRWVQPRLVGEVEYRTLTHDAR
LRHSVWRGLRPDRDPHEVRIDGAFARAPLASYGVRAPAPEPARAPAASEPAEAASARAEA
PAERVRAATGDELAALDALRRKGTWHVAGEEVALTNLDKVLFPGRDGGPPVTKRDFVRYH
ARVAPYLLPYLQGRPVNMQRFPDGVAREGFWQKEIPVHAPDWVTRWRYPDAEPGDVQDYV
VVDSTATLVWLANLAAVELHPWTSRLPDVHRPTWALIDIDPGPRTAFDEVLAVARLYRAA
LDHLGVAAAPKVTGKRGVQIWVPVTPGPTFADTRGWVEKVSRAVGRMVPELISWEWHTDR
RAGRMRLDYTQNVINKTLVAPFSARPAAGAPVSMTLSWDELDDPELRPDRWTVGTALDRL
DAVGDPMFPLVGREQVLPELGGV
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccgccggcccgacgccgccctgcggccgatgctggccacccccggccgcccg
ccgtccggtcccgggtgggcggtggagttcaagtgggacggcgtgcgcgccctgctcgac
gtcgacgacgcgggcgaggtgcacctgaccagccgcaacggcaacgacgtcacgctgggc
taccccgatctgctggccggcgtcgacaccgggcagcccctggtgctcgacggcgagatc
gtcgcgctcgacgaggcgggccgtcccgacttcgggctgctgcagaaccgcatgcacgtc
cggcacccgtccgggccgctgctcgccgaggtcccggtgcgcttctacgcgttcgacgtg
ctgcgcgtcggtcagcgctcgctgctgcgcgagacctacgacgaccggcgcgcggcactc
gccggcctcggtgtcgacggctgggcccgcttcgcggtgccgccgtcgacgaccgaggtg
ccgcccgcgcagatgctcgacgtcgcgcgcgagcacggcctggaggggatcgtcgccaag
aggcggacgtcgcgctacgagcccgggcggcgggcggcatcgtgggtgaagacggcgctg
ttcaccacgcgggaggtcgtcctcggcggctggacgccagggcagggccgccgcggcgcg
ctcggctcgttgctgctcggcgcctacgacgacgagggccggctccactacctgggcaac
gtgggcagcgggttcagcgaggccgcgctgcggtcgctgcgggagaagctcgaacagctg
cgcagcgacgaggatcccttcgcctccggcgtgccgcgcgaacacgcccgtggtgtgcgg
tgggtgcagccgcggctggtcggggaggtcgagtaccgcacgctcacccacgacgcccgg
ctgcggcactcggtgtggcgggggctgcgtcccgaccgcgacccgcacgaggtgcgtatc
gacggcgcgttcgcgcgggcaccgctggcgtcctacggcgtgcgcgcgccggcccccgag
cccgcgcgggcgcccgcagcgtcggagccagcggaagcagcgtcggcgagagcggaggcg
ccggccgagcgggtccgggccgccaccggcgacgagctcgccgccctcgacgccctgcgc
cgcaagggcacctggcacgtcgcgggcgaggaggtcgcgctgacgaacctcgacaaggtg
ctgttccccggccgcgacggcgggccgcccgtcacgaagcgggacttcgtgcgctaccac
gcgcgcgtcgcgccgtacctgctgccgtacctgcaggggcggccggtgaacatgcagcgc
ttccccgacggcgtggcgcgggagggcttctggcagaaggagatcccggtccacgcgccg
gactgggtgacgcgctggcgctaccccgacgccgaacccggcgacgtgcaggactacgtc
gtcgtcgacagcaccgcgacgctcgtgtggctggccaacctcgccgcggtcgagctgcac
ccctggacctcgcggctgcccgacgtccaccggcccacctgggcgttgatcgacatcgac
ccgggtccgcgcacggcgttcgacgaggtgctcgccgtcgcgaggctctaccgcgccgcg
ctcgaccacctgggcgtcgccgcggcgcccaaggtcaccggcaagcggggggtccagatc
tgggtcccggtgacgcccggtccgacgttcgccgacacccgcgggtgggtcgagaaggtg
tcgcgggccgtggggcgcatggtccccgagctgatctcctgggagtggcacaccgaccgc
cgggcggggcggatgcgcctggactacacgcagaacgtcatcaacaagacgctcgtcgcg
ccgttcagcgcccggcccgcggccggcgccccggtgtcgatgacgttgagctgggacgag
ctcgacgaccccgagctgcggcccgaccgctggacggtcgggaccgcgctcgaccggctc
gacgccgtcggcgacccgatgttcccgctggtcggacgcgagcaggtcctgccggagcta
gggggcgtctga

DBGET integrated database retrieval system