KEGG   Pseudonocardia dioxanivorans: Psed_5077Help
Entry
Psed_5077         CDS       T01479                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00564  Glycerophospholipid metabolism
pdx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Psed_5077
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Psed_5077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N Fn3-like GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEA27215
UniProt: F4CQ19
LinkDB All DBs
Position
5435068..5436777
Genome map
AA seq 569 aa AA seqDB search
MRSVALSPQARAEALRAMAGTELDVLVIGGGVVGAGSALDAATRGLTVGLVEARDFASGT
SSRSSKLIHGGLRYLEMLDFRLVAEALQERGLLIQTLAPHLVRPVPFIYPLQHRVWERAY
AGAGVALYDTLGLLSGRARGVPHHRHLTRTGAKRIMPSLRKEALVGALQYYDAQVDDARH
TMFVARTAAAYGAHIASRARVVALLREGERVTGAEVHDLESGETIKVRARQVVNATGVWT
DDTQSLVGERGQFKVRASKGIHLVVPRDRIQGDSGLILRTEKSVLFVIPWFRHWIIGTTD
TDWSLDKAHPAASAADIDYLLDHANAVLEQPLTHADVEGVYAGLRPLLSGESESTSKLSR
EHAVAHTVPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDAKVPESVTEKVPLLGAEGFKAL
LNARHRLAAEHGLHVARIEHLLSRYGSMIDEVLALVDEDPTLGEPLAGAPDYLRAEIVYA
ASHEGARHLEDVLARRTRISIETFDRGVGSVEEAARLLAPVLGWSDEQVEREKEHYRKRV
DAERESQKMPDDETADAARMGAPEVVPLA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggtcgcgctctccccgcaggcccgggccgaggccctgcgcgccatggcgggg
accgagctcgacgtgctcgtgatcggtggtggcgtcgtgggcgcgggcagtgccctcgac
gccgccacccgcgggctgaccgtcgggctcgtcgaggcccgggacttcgcgtccgggacg
tcgagccgttcgagcaagctcatccacggcggtctgcggtatctggagatgctcgacttc
cggctggtcgcggaggcgctgcaggaacgcgggctgctcatccagacgctggcgccgcac
ctggtgcgtccggtgccgttcatctacccgctgcagcaccgggtgtgggagcgggcgtac
gccggtgcgggcgtcgcgctctacgacaccctcggcctgctgtcgggccgggcccgcggc
gtgccccaccaccggcacctcacgcgcacgggtgcgaagcggatcatgccgtcgctgcgc
aaggaggcgctggtcggcgccctgcagtactacgacgcgcaggtcgacgacgcccgccac
acgatgttcgtcgcccgcacggcggcggcgtacggggcgcacatcgcgtcccgggcgcgg
gtcgtggcgctgctgcgcgagggcgagcgggtcaccggcgccgaggtgcacgacctcgag
tccggcgagacgatcaaggtcagggccaggcaggtcgtcaacgccacgggggtgtggacc
gacgacacccagagcctcgtcggcgagcgcggccagttcaaggtgcgggccagcaagggc
atccacctcgtggtgccgcgcgaccgcatccagggcgactccgggctgatcctgcgcacc
gagaagtcggtgctgttcgtgatcccgtggttccggcactggatcatcggcacgaccgac
accgactggtcgctcgacaaggcccaccccgcggcgagcgcggccgacatcgactacctg
ctcgaccacgccaacgccgtgctggagcaaccgctcacgcacgccgacgtcgagggcgtc
tacgccgggctgcggccgctgctgtcgggcgagtcggagtcgacgtcgaagctctcgcgc
gagcacgcggtggcgcacacggtgccgggtctggtcgtcgtcgcgggcggcaagtacacg
acctaccgcgtcatggccaaggacgcggtcgacgccgccgtccacgggttggacgcgaag
gtgccggagtcggtcaccgagaaggtgccgctgctgggcgcggaggggttcaaggccctg
ctcaacgcccggcaccggctcgcggccgagcacggcctgcacgtcgcccggatcgagcac
ctgctcagccggtacggctcgatgatcgacgaggtgctcgcgctggtcgacgaggacccg
acgctgggcgagccgctggccggggcgcccgactacctgcgcgccgagatcgtctatgcg
gcctcgcacgagggtgcccggcacctggaggacgtgctggcccgccgtacccgtatctcg
atcgagaccttcgaccgcggcgtcgggtccgtcgaggaggcggcgcggctgctggcgccg
gtgctcggctggagcgacgagcaggtcgagcgcgagaaggagcactaccgcaagcgggtc
gacgccgaacgggagagccagaagatgcccgacgacgagaccgccgacgccgcccggatg
ggcgcaccggaggtcgtcccgctggcctga

DBGET integrated database retrieval system