KEGG   Pseudonocardia dioxanivorans: Psed_5144Help
Entry
Psed_5144         CDS       T01479                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
pdx  Pseudonocardia dioxanivorans
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psed_5144
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Psed_5144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AEA27281
UniProt: F4CRR4
LinkDB All DBs
Position
5507656..5508069
Genome map
AA seq 137 aa AA seqDB search
MRLSRIFRPQLEATAHCDLPCGVYDPAQARIEAESVKAIQEKYQGNDDPVFRERAIEIKE
QRSDLVKHHLWVLWTDYFKPPHFEKYPELHELFNKATKKAGGGPGGTKSSVDPKDGQELL
DYIAQIDKIFWETKQAA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcccgcatcttccgaccgcagctcgaggccaccgcgcactgcgacctcccc
tgcggcgtctacgaccccgcccaggcccgcatcgaggccgagtcggtcaaggcgatccag
gagaagtaccagggcaacgacgacccggtcttccgggagcgggccatcgagatcaaggag
cagcgctccgacctcgtcaagcaccacctgtgggtgctgtggaccgactacttcaagccg
ccgcacttcgagaagtacccggagctgcacgagctgttcaacaaggccaccaagaaggcc
ggcggcggccccggtggcaccaagtcctcggtcgacccgaaggacggccaggagctgctc
gactacatcgcccagatcgacaagatcttctgggagaccaagcaggctgcctga

DBGET integrated database retrieval system