KEGG   Pseudonocardia dioxanivorans: Psed_5312Help
Entry
Psed_5312         CDS       T01479                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00020  Citrate cycle (TCA cycle)
pdx00480  Glutathione metabolism
pdx01100  Metabolic pathways
pdx01110  Biosynthesis of secondary metabolites
pdx01120  Microbial metabolism in diverse environments
pdx01130  Biosynthesis of antibiotics
pdx01200  Carbon metabolism
pdx01210  2-Oxocarboxylic acid metabolism
pdx01230  Biosynthesis of amino acids
Module
pdx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pdx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pdx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psed_5312
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psed_5312
Enzymes [BR:pdx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Psed_5312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AEA27446
UniProt: F4CUX7
LinkDB All DBs
Position
complement(5674702..5675916)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIETRDKTDDQITVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWTKPIIVGRHAFGDQYRATDFKFPGEGTLTVTFTPADGSEPIQHEVFQAPGSGVAMA
MYNLDESIRDFARASMNYGLTRDYPVYLSTKNTILKAYDGRFKDLFAEVYETEFKEQFEA
KGLTYEHRLIDDMVAAALKWEGGYVWAAKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGK
TVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTRGLAHRGKLDNNPELIAFSEALED
VVVKTVESGKMTKDLALLIDKDAPFQTTEEFLETLDANLQKARA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgagggcacggtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctgatccacccgtatctggacgtgaatctcgag
tactacgacctcgggatcgagacccgggacaagaccgacgaccagatcaccgtcgacgcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacccccgacgag
gcccgcgtcgaggagttcggcctgaagaagatgtggcggtccccgaacgggacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatcatctcgaacatcccgcgcctg
gtgccgggctggacgaagccgatcatcgtcggccgccacgccttcggcgaccagtaccgc
gccacggacttcaagttcccgggcgagggcacgctgacggtcaccttcaccccggccgac
ggctcggagcccatccagcacgaggtcttccaggccccgggctcgggcgtcgcgatggcc
atgtacaacctcgacgagtcgatccgcgacttcgcgcgcgcgtcgatgaactacggcctc
acccgggactacccggtctacctctcgaccaagaacacgatcctcaaggcctacgacggt
cgcttcaaggacctgttcgccgaggtctacgagacggagttcaaggagcagttcgaggcc
aagggcctgacctacgagcaccgcctgatcgacgacatggtcgccgcggcgctgaagtgg
gagggcggctacgtgtgggccgccaagaactacgacggtgacgtgcagtccgacaccgtg
gcccagggcttcggctcgctcggcctcatgacgtccgtcctcatgacgcccgacggcaag
accgtggaggccgaggctgcccacggcaccgtcacccgccactaccgccagcaccaggcc
ggcaagccgacgtcgaccaacccgatcgcgtcgatctacgcctggacccggggcctggcc
caccgcggcaagctcgacaacaaccccgagctcatcgcgttcagcgaggcgctcgaggac
gtcgtggtgaagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctgatcgac
aaggacgcgccgttccagaccaccgaggagttcctcgagacgctggacgcgaacctgcag
aaggcccgcgcctga

DBGET integrated database retrieval system