KEGG   Pseudonocardia dioxanivorans: Psed_6250Help
Entry
Psed_6250         CDS       T01479                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pdx  Pseudonocardia dioxanivorans
Pathway
pdx00630  Glyoxylate and dicarboxylate metabolism
pdx00710  Carbon fixation in photosynthetic organisms
pdx01100  Metabolic pathways
pdx01120  Microbial metabolism in diverse environments
pdx01200  Carbon metabolism
Module
pdx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pdx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psed_6250
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Psed_6250
Enzymes [BR:pdx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Psed_6250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Acetyltransf_17
Motif
Other DBs
NCBI-ProteinID: AEA28351
UniProt: F4CQ78
LinkDB All DBs
Position
6612473..6612898
Genome map
AA seq 141 aa AA seqDB search
MRITQGTFSYLPDFTDEEITAQINYALTNDWPLSVEFTDDPHPRNTYWEMWGLPMFDLRD
PAGVLMEVNACRAANPNAYVRLNAYDASLGRQTTALSFIVQRPAEEPGFRLDRAEGRGRA
IGYTTHSYATERPVGDRYTQG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcacgcagggcaccttctcgtatctccccgacttcaccgacgaggagatcacc
gcccagatcaactacgcgctgaccaacgactggccgctgtcggtcgagttcaccgacgac
ccgcacccccgcaacacgtactgggagatgtgggggctgccgatgttcgacctgagggac
ccggcgggcgtgctgatggaggtcaacgcctgccgggcggcgaacccgaacgcctacgtg
cggctcaacgcctacgacgcgagcctcggccggcagacgaccgccctgtcgttcatcgtg
cagcgtcccgccgaggagcccggcttccgcctggaccgcgcggagggcaggggtcgcgcg
atcggctacacgacgcactcgtacgcgaccgagcgcccggtcggcgaccgctacacccag
ggctga

DBGET integrated database retrieval system