KEGG   Phytobacter diazotrophicus: HHA33_11055
Entry
HHA33_11055       CDS       T06586                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
pdz  Phytobacter diazotrophicus
Pathway
pdz00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:pdz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    HHA33_11055
Enzymes [BR:pdz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     HHA33_11055
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: QJF17046
LinkDB
Position
2340431..2341531
AA seq 366 aa
MPTPVTQPFLPPLEEFVPYLQQIWENKWLTNNGPFHQELEKEVCKYLGVEHISLFTNGTI
ALVTALQALRITGEVITTPYSFVATSHSLIWNDLKPVFVDIDPKTFNIDPAKIEAAITPK
TTAIMPVHCYANPCDVHAIQKIADNYGLRVIYDAAHAFGVDYEGTSLLNHGDMSVLSFHA
TKVFNTFEGGAIVCPDLKTKQRIDYLKNFGFADEVTVTAPGINGKMSEINAAFGLLQLKY
IDKAISDRQVIDQHYRDELKKVPGIIVPEKSSKASSNYSYFPVIVDDSYPLTRDEVYSKL
KANDILSRRYFYPLISDMPMYRSLESSRPDNLSEAKYIADRVLCLPIFSALDRETQDKII
ALIAEG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgccaaccccagttacacaaccatttcttcctccgcttgaagagtttgttccatatctg
caacagatctgggaaaacaaatggttaacaaacaatggcccttttcaccaggaactcgaa
aaggaagtttgtaaatatcttggtgttgagcatatttctcttttcaccaatggcacaatt
gctctggttactgcgcttcaggcattaagaattactggtgaagttatcacgacaccttat
tctttcgttgcaacttcacattctttaatttggaacgatttaaaacctgtatttgttgat
attgatccgaaaacattcaatattgaccctgctaaaattgaagcggctattacaccgaaa
actactgcgatcatgcctgtccattgctatgcgaatccgtgtgatgtacatgctatccaa
aaaattgctgataattatggtttgcgtgtcatttacgatgctgcgcatgccttcggggtt
gattacgaaggaaccagtttactgaatcatggtgatatgtcggtacttagtttccatgca
acgaaagtattcaatacttttgaaggtggcgcgatcgtttgtccagatctgaaaacaaaa
cagcgtattgattatcttaaaaactttggttttgctgatgaagtcaccgttaccgctccg
ggcattaacggtaaaatgagtgaaataaatgcagcttttggcctattacaacttaaatac
attgataaagcgattagcgatcgtcaggttatcgatcagcattatcgtgatgaactgaaa
aaagtaccaggaatcattgtacctgagaaatcatcaaaagcgtcgagtaattattcatac
ttccctgtcattgtcgatgatagctatccactaacgcgagatgaagtttattcgaaatta
aaagcgaatgatattctttcacgtcgctacttctatccattaattagcgacatgccgatg
tatcgctcactagagtcctccagacctgataacctcagcgaagctaaatatatagcagac
cgtgtattatgtcttccgatatttagtgctcttgatcgcgagacgcaagacaagattatt
gctttaattgctgagggttaa

DBGET integrated database retrieval system