KEGG   Pseudoalteromonas espejiana: PESP_a0263
Entry
PESP_a0263        CDS       T04989                                 
Name
(GenBank) hypothetical protein
  KO
K11530  (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase [EC:5.3.1.32]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pea00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PESP_a0263
Enzymes [BR:pea01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.32  (4S)-4-hydroxy-5-phosphooxypentane-2,3-dione isomerase
     PESP_a0263
SSDB
Motif
Pfam: ABM
Other DBs
NCBI-ProteinID: ASM48530
LinkDB
Position
I:252820..253173
AA seq 117 aa
MSEQITWTVEGQIKDGKYDQFLEVMQQLIALAKSEAGTVMYEWTISEDKRNVHIYERYQN
EAAAKLHLQGWGESGPLFLSVVDMQRVTVYSQLSEEFAKAFAGPSTVFMTPIGGFVN
NT seq 354 nt   +upstreamnt  +downstreamnt
gtgagtgagcaaataacctggaccgtagaaggccaaattaaagacggcaaatacgatcag
tttttagaggtaatgcagcaacttattgctttagctaaaagcgaagcgggcactgtaatg
tacgagtggacgataagtgaagataaacgcaatgtacatatttacgagcgctatcaaaac
gaggccgcggctaaattacacctacaagggtggggcgaaagcggcccattgtttttaagt
gtggttgatatgcagcgagtgactgtatacagccagcttagtgaagaatttgctaaagcc
tttgcaggtcctagcactgtatttatgacacccataggtgggtttgtaaattag

DBGET integrated database retrieval system