KEGG   Pseudoalteromonas espejiana: PESP_a0980Help
Entry
PESP_a0980        CDS       T04989                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea00250  Alanine, aspartate and glutamate metabolism
pea00410  beta-Alanine metabolism
pea00430  Taurine and hypotaurine metabolism
pea00650  Butanoate metabolism
pea01100  Metabolic pathways
pea01110  Biosynthesis of secondary metabolites
pea01120  Microbial metabolism in diverse environments
pea02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PESP_a0980 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PESP_a0980 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PESP_a0980 (gadB)
   00430 Taurine and hypotaurine metabolism
    PESP_a0980 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PESP_a0980 (gadB)
Enzymes [BR:pea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PESP_a0980 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASM49154
UniProt: A0A221I5M7
LinkDB All DBs
Position
I:954158..955783
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQAAVIPENPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYSQDESFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGNFKGIGAQGLIAGMLHYGYKGLAILVSERGHYSLGKSIDLLGIGRENL
IGVKTCENNKVDVNAMRDKALELESQGIKVMAIVGVAGTTETGNIDPLEAMADLAQEINC
HFHVDAAWGGATLLSQTHRPLLKGIERADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFADLI
KADEDFELISEPELCLLTYRYVPKKIKQAIAEADEKTRIDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPSKYDNQPTVVFRVVLANPLTSGVILKEILAEQKELAKSDPVFKKYLSKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgcctgactcaactttaagcaaaatagagcttgaaatttcgagtaatttagca
gggtttttaaacgaaaatatagcggcaattgaaaagccgttacatgaaattgaaaaagat
tttcaagctgcggtgatcccagaaaacccaacgtttgtatctgcttacgcccaagacatt
atggagcaacttgttgcccattctgtgcatacggctgcgcccagctttattggccatatg
acatcggctttaccgcattttttactgccgctttctaagttgatggttgggctaaaccaa
aacttggtaaaaatagaaacctctaaagcatttacccctttagagcgccaagtactaggc
atgatgcaccatttagcttactcgcaagatgagtcgttctattcaaagtggatgcacagc
gctaaaacatcactcggtgcattttgctccggtggtacagtggcaaacattactgcattg
tggatagcgcgtaaccgcctgttaaagcctgatggaaactttaaaggtataggtgcacag
ggcttaattgctggtatgttgcattatggctataaaggtttggctatattggtttctgag
cgtgggcattactcgttaggtaaatcaattgatttactgggcatagggcgcgaaaaccta
attggtgttaaaacctgcgaaaataataaggttgatgtaaatgctatgcgagataaggcc
ttagagcttgagtcgcaaggtataaaggtaatggcaattgtgggtgtggcagggactacc
gaaaccggtaatattgacccgctcgaagctatggccgacttagcacaagaaataaattgc
cactttcatgtagatgcagcatggggtggagcgacgcttttatcgcaaacacatcgccca
cttttaaaagggattgagcgtgcagactctattacgatagatgcgcacaagcaaatgtat
gttcctatgggcgcgggcttagtgttatttaaagaccccgcagcaaccgatgcgattgaa
catcatgctgagtatattttacgtaaaggctcaaaagatttaggtagccatacacttgaa
ggcagccgcccaggtatggctatgttagtgcatgcttgcttacgtgttattggccgtaaa
ggctacgaaatgctaattgatcgtagcattaaaaaagctcattactttgccgatttaatt
aaagcggatgaagattttgagcttatttcggagccagagctgtgcttattaacgtatcgt
tatgttcctaaaaaaattaagcaagccattgcagaagctgatgaaaaaacacgtattgat
atttttgcctcattaaatcgttttacagccagtatgcaaaaacgccagcgtgagtcgggt
cgctcgtttgtatcgcgtacacgtttaacgccttcaaagtacgataaccaacccacggtt
gtgtttagagtcgtgcttgcaaacccgctaacatcgggtgttatattaaaagaaattttg
gctgagcaaaaagagctggctaagtcagatccggtgtttaaaaagtatttaagtaaatat
atgtaa

DBGET integrated database retrieval system