KEGG   Pseudoalteromonas espejiana: PESP_a1136Help
Entry
PESP_a1136        CDS       T04989                                 

Gene name
lig
Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pea  Pseudoalteromonas espejiana
Pathway
pea03030  DNA replication
pea03410  Base excision repair
pea03420  Nucleotide excision repair
pea03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pea00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PESP_a1136 (lig)
   03410 Base excision repair
    PESP_a1136 (lig)
   03420 Nucleotide excision repair
    PESP_a1136 (lig)
   03430 Mismatch repair
    PESP_a1136 (lig)
Enzymes [BR:pea01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PESP_a1136 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     PESP_a1136 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PESP_a1136 (lig)
DNA replication proteins [BR:pea03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PESP_a1136 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PESP_a1136 (lig)
DNA repair and recombination proteins [BR:pea03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PESP_a1136 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     PESP_a1136 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     PESP_a1136 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M Qn_am_d_aII
Motif
Other DBs
NCBI-ProteinID: ASM49289
UniProt: A0A221I618
LinkDB All DBs
Position
I:1097740..1098582
Genome map
AA seq 280 aa AA seqDB search
MAFIKCLLILLSVVFTHAIYAVQPDVLLAKVYDESKHGNIEDYLVSEKFDGVRAIWTGDK
LITRKGNAINAPAWFTTPLPPIWLDGELWIARNKFALVSGIVRTKIPNNHDWQSVVYQVF
DMPDPTLPFSARYKSYTDLVAGLNTAHIKAVKQHRFENTQLLTHYFKDITKQGAEGVMLH
LASAVHKSGRNNTLLKLKPYLDAEALVIEHLPGKGKYTGMLGALKVKTASGQTFKIGTGF
SDAQRQTPPAIGSTITYRYHGLTKNGLPRFASFLRVREPL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcttttataaagtgccttttaattttattaagtgtcgtgtttacacacgctatttat
gcggtgcagccagatgtacttttagcaaaagtatatgacgagtctaaacatggcaatatt
gaagattacttagtcagtgaaaagtttgacggtgtaagagcaatatggactggcgataaa
ctaattactcgtaaagggaatgccataaatgcgccagcatggtttacaacaccgcttccg
ccaatatggcttgatggagagctgtggatagcacgaaataaatttgcactagtcagcggt
atcgtaagaaccaaaatacctaataaccacgactggcagagcgttgtgtatcaagtattt
gatatgccagatcctacccttccttttagcgctcgttataaaagctatactgatttagtc
gcaggcctaaatacagcgcacattaaagctgttaaacagcatcgttttgaaaatactcag
ttattaactcattattttaaagacataacaaagcaaggtgctgaaggggttatgttgcac
cttgcaagcgctgttcataaaagtgggcggaataatacgctactaaaattaaagccctat
ttagacgcagaagcccttgtaatagagcacctaccaggtaaaggtaaatacacaggtatg
ttaggtgcgttaaaagtaaaaacagcgagtggccaaacatttaaaataggcaccggtttt
agtgatgctcaacgccaaacccctccggctataggcagtacgataacgtaccgctaccat
ggcctaacaaaaaatggtttgccacgttttgccagctttttaagagtaagggagccttta
taa

DBGET integrated database retrieval system